eF-site ID 1cch-A PDB Code 1cch Chain A click to enlarge Title THE SOLUTION CONFORMATION OF CYTOCHROME C-551 FROM P.STUTZERI ZOBELL DETERMINED BY NMR+ Classification ELECTRON TRANSPORT Compound CYTOCHROME C551 Source Pseudomonas stutzeri (Pseudomonas perfectomarina) (CY551_PSEST) Sequence A:  QDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVEGA ADTLALHIKNGSQGVWGPIPMPPNPVTEEEAKILAEWVLS LK Description (1)  CYTOCHROME C551 (NMR, MINIMIZED AVERAGE STRUCTURE) Functional site 1) chain A residue 12 type sequence C description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 2) chain A residue 15 type sequence C description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 3) chain A residue 16 type sequence H description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 4) chain A residue 44 type sequence L description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 5) chain A residue 47 type sequence H description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 6) chain A residue 48 type sequence I description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 7) chain A residue 52 type sequence S description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 8) chain A residue 53 type sequence Q description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 9) chain A residue 54 type sequence G description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 10) chain A residue 55 type sequence V description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 11) chain A residue 56 type sequence W description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 12) chain A residue 57 type sequence G description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 13) chain A residue 59 type sequence I description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 14) chain A residue 61 type sequence M description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 15) chain A residue 62 type sequence P description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 16) chain A residue 64 type sequence N description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 17) chain A residue 66 type sequence V description BINDING SITE FOR RESIDUE HEC A 83 source : AC1 18) chain A residue 12 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 15 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 16 type BINDING sequence H description axial binding residue => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI2 21) chain A residue 61 type BINDING sequence M description axial binding residue => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links