eF-site ID 1c8t-A PDB Code 1c8t Chain A click to enlarge Title HUMAN STROMELYSIN-1 (E202Q) CATALYTIC DOMAIN COMPLEXED WITH RO-26-2812 Classification HYDROLASE/HYDROLASE INHIBITOR Compound STROMELYSIN-1 Source Homo sapiens (Human) (MMP3_HUMAN) Sequence A:  FPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWE EVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLA HAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHQIGH SLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSL YGPPPDP Description Functional site 1) chain A residue 201 type sequence H description BINDING SITE FOR RESIDUE ZN A 260 source : AC6 2) chain A residue 205 type sequence H description BINDING SITE FOR RESIDUE ZN A 260 source : AC6 3) chain A residue 211 type sequence H description BINDING SITE FOR RESIDUE ZN A 260 source : AC6 4) chain A residue 151 type sequence H description BINDING SITE FOR RESIDUE ZN A 261 source : AC7 5) chain A residue 153 type sequence D description BINDING SITE FOR RESIDUE ZN A 261 source : AC7 6) chain A residue 166 type sequence H description BINDING SITE FOR RESIDUE ZN A 261 source : AC7 7) chain A residue 179 type sequence H description BINDING SITE FOR RESIDUE ZN A 261 source : AC7 8) chain A residue 158 type sequence D description BINDING SITE FOR RESIDUE CA A 262 source : AC8 9) chain A residue 159 type sequence G description BINDING SITE FOR RESIDUE CA A 262 source : AC8 10) chain A residue 161 type sequence G description BINDING SITE FOR RESIDUE CA A 262 source : AC8 11) chain A residue 163 type sequence V description BINDING SITE FOR RESIDUE CA A 262 source : AC8 12) chain A residue 181 type sequence D description BINDING SITE FOR RESIDUE CA A 262 source : AC8 13) chain A residue 184 type sequence E description BINDING SITE FOR RESIDUE CA A 262 source : AC8 14) chain A residue 141 type sequence D description BINDING SITE FOR RESIDUE CA A 263 source : AC9 15) chain A residue 173 type sequence G description BINDING SITE FOR RESIDUE CA A 263 source : AC9 16) chain A residue 175 type sequence N description BINDING SITE FOR RESIDUE CA A 263 source : AC9 17) chain A residue 177 type sequence D description BINDING SITE FOR RESIDUE CA A 263 source : AC9 18) chain A residue 107 type sequence D description BINDING SITE FOR RESIDUE CA A 264 source : BC1 19) chain A residue 182 type sequence D description BINDING SITE FOR RESIDUE CA A 264 source : BC1 20) chain A residue 184 type sequence E description BINDING SITE FOR RESIDUE CA A 264 source : BC1 21) chain A residue 162 type sequence N description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 22) chain A residue 163 type sequence V description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 23) chain A residue 164 type sequence L description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 24) chain A residue 165 type sequence A description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 25) chain A residue 197 type sequence L description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 26) chain A residue 201 type sequence H description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 27) chain A residue 202 type sequence Q description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 28) chain A residue 211 type sequence H description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 29) chain A residue 217 type sequence A description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 30) chain A residue 218 type sequence L description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 31) chain A residue 220 type sequence Y description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 32) chain A residue 221 type sequence P description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 33) chain A residue 222 type sequence L description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 34) chain A residue 223 type sequence Y description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 35) chain A residue 224 type sequence H description BINDING SITE FOR RESIDUE TR1 A 265 source : BC2 36) chain A residue 87 type sequence P description BINDING SITE FOR RESIDUE TR1 B 265 source : BC3 37) chain A residue 215 type sequence T description BINDING SITE FOR RESIDUE TR1 B 265 source : BC3 38) chain A residue 216 type sequence E description BINDING SITE FOR RESIDUE TR1 B 265 source : BC3 39) chain A residue 107 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 40) chain A residue 173 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 41) chain A residue 175 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 42) chain A residue 177 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 43) chain A residue 179 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 44) chain A residue 181 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 45) chain A residue 182 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 46) chain A residue 184 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 47) chain A residue 141 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 48) chain A residue 151 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 49) chain A residue 153 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 50) chain A residue 158 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 51) chain A residue 159 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 52) chain A residue 161 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 53) chain A residue 163 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI2 54) chain A residue 166 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 55) chain A residue 201 type BINDING sequence H description BINDING => ECO:0000269|PubMed:8740360 source Swiss-Prot : SWS_FT_FI3 56) chain A residue 205 type BINDING sequence H description BINDING => ECO:0000269|PubMed:8740360 source Swiss-Prot : SWS_FT_FI3 57) chain A residue 211 type BINDING sequence H description BINDING => ECO:0000269|PubMed:8740360 source Swiss-Prot : SWS_FT_FI3 58) chain A residue 202 type ACT_SITE sequence Q description source Swiss-Prot : SWS_FT_FI1 59) chain A residue 201 type catalytic sequence H description 591 source MCSA : MCSA1 60) chain A residue 202 type catalytic sequence Q description 591 source MCSA : MCSA1 61) chain A residue 205 type catalytic sequence H description 591 source MCSA : MCSA1 62) chain A residue 211 type catalytic sequence H description 591 source MCSA : MCSA1

Display surface Download Links