eF-site ID 1c3v-A PDB Code 1c3v Chain A click to enlarge Title DIHYDRODIPICOLINATE REDUCTASE FROM MYCOBACTERIUM TUBERCULOSIS COMPLEXED WITH NADPH AND PDC Classification OXIDOREDUCTASE Compound DIHYDRODIPICOLINATE REDUCTASE Source (DAPB_MYCTU) Sequence A:  MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSL LTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFT AERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAA RFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPP NPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGT EGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEP LLDLH Description Functional site 1) chain A residue 507 type sequence G description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 2) chain A residue 509 type sequence K description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 3) chain A residue 510 type sequence G description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 4) chain A residue 511 type sequence K description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 5) chain A residue 512 type sequence V description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 6) chain A residue 533 type sequence D description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 7) chain A residue 534 type sequence A description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 8) chain A residue 552 type sequence F description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 9) chain A residue 553 type sequence T description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 10) chain A residue 557 type sequence V description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 11) chain A residue 575 type sequence G description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 12) chain A residue 577 type sequence T description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 13) chain A residue 602 type sequence A description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 14) chain A residue 603 type sequence P description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 15) chain A residue 604 type sequence N description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 16) chain A residue 605 type sequence F description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 17) chain A residue 636 type sequence K description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 18) chain A residue 717 type sequence F description BINDING SITE FOR RESIDUE NDP A 801 source : AC1 19) chain A residue 577 type sequence T description BINDING SITE FOR RESIDUE PDC A 802 source : AC3 20) chain A residue 603 type sequence P description BINDING SITE FOR RESIDUE PDC A 802 source : AC3 21) chain A residue 604 type sequence N description BINDING SITE FOR RESIDUE PDC A 802 source : AC3 22) chain A residue 633 type sequence H description BINDING SITE FOR RESIDUE PDC A 802 source : AC3 23) chain A residue 636 type sequence K description BINDING SITE FOR RESIDUE PDC A 802 source : AC3 24) chain A residue 641 type sequence S description BINDING SITE FOR RESIDUE PDC A 802 source : AC3 25) chain A residue 642 type sequence G description BINDING SITE FOR RESIDUE PDC A 802 source : AC3 26) chain A residue 643 type sequence T description BINDING SITE FOR RESIDUE PDC A 802 source : AC3 27) chain A residue 692 type sequence A description BINDING SITE FOR RESIDUE PDC A 802 source : AC3 28) chain A residue 704 type sequence T description BINDING SITE FOR RESIDUE PG4 B 2000 source : AC5 29) chain A residue 706 type sequence T description BINDING SITE FOR RESIDUE PG4 B 2000 source : AC5 30) chain A residue 708 type sequence R description BINDING SITE FOR RESIDUE PG4 B 2000 source : AC5 31) chain A residue 710 type sequence D description BINDING SITE FOR RESIDUE PG4 B 2000 source : AC5 32) chain A residue 632 type ACT_SITE sequence H description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_00102 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 627-644 type prosite sequence EVIELHHPHKADAPSGTA description DAPB Dihydrodipicolinate reductase signature. EViElHhphKaDapSGTA source prosite : PS01298 34) chain A residue 636 type ACT_SITE sequence K description Proton donor => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 35) chain A residue 511 type BINDING sequence K description BINDING => ECO:0000269|PubMed:12962488, ECO:0007744|PDB:1C3V source Swiss-Prot : SWS_FT_FI3 36) chain A residue 575 type BINDING sequence G description BINDING => ECO:0000269|PubMed:12962488, ECO:0007744|PDB:1C3V source Swiss-Prot : SWS_FT_FI3 37) chain A residue 602 type BINDING sequence A description BINDING => ECO:0000269|PubMed:12962488, ECO:0007744|PDB:1C3V source Swiss-Prot : SWS_FT_FI3 38) chain A residue 636 type BINDING sequence K description BINDING => ECO:0000269|PubMed:12962488, ECO:0007744|PDB:1C3V source Swiss-Prot : SWS_FT_FI3 39) chain A residue 533 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12962488, ECO:0000269|PubMed:20057050, ECO:0007744|PDB:1P9L, ECO:0007744|PDB:1YL7 source Swiss-Prot : SWS_FT_FI4 40) chain A residue 633 type BINDING sequence H description BINDING => ECO:0000305|PubMed:12962488, ECO:0007744|PDB:1C3V, ECO:0007744|PDB:1P9L source Swiss-Prot : SWS_FT_FI5 41) chain A residue 642 type BINDING sequence G description BINDING => ECO:0000305|PubMed:12962488, ECO:0007744|PDB:1C3V, ECO:0007744|PDB:1P9L source Swiss-Prot : SWS_FT_FI5

Display surface Download Links