eF-site ID 1c2u_4-A PDB Code 1c2u Model 4 Chain A click to enlarge Title SOLUTION STRUCTURE OF [ABU3,35]SHK12-28,17-32 Classification TOXIN Compound SYNTHETIC PEPTIDE ANALOGUE OF SHK TOXIN Source (TXSHK_STOHE) Sequence A:  RSXIDTIPKSRCTAFQCKHSAKYRLSFCRKTCGTX Description Functional site 1) chain A residue 11 type SITE sequence R description Important residue for binding Kv1.3/KCNA3 => ECO:0000269|PubMed:26288216, ECO:0000269|PubMed:8645244 source Swiss-Prot : SWS_FT_FI3 2) chain A residue 22 type SITE sequence K description Key residue for binding both Kv1.2/KCNA2 and Kv1.3/KCNA3 (occludes the channel pore like a cork in a bottle) => ECO:0000269|PubMed:26288216, ECO:0000269|PubMed:8645244 source Swiss-Prot : SWS_FT_FI4 3) chain A residue 7 type SITE sequence I description Important residue for binding Kv1.3/KCNA3 => ECO:0000269|PubMed:26288216 source Swiss-Prot : SWS_FT_FI1 4) chain A residue 20 type SITE sequence S description Important residue for binding Kv1.3/KCNA3 => ECO:0000269|PubMed:26288216 source Swiss-Prot : SWS_FT_FI1 5) chain A residue 21 type SITE sequence A description Important residue for binding Kv1.3/KCNA3 => ECO:0000269|PubMed:26288216 source Swiss-Prot : SWS_FT_FI1 6) chain A residue 23 type SITE sequence Y description Important residue for binding Kv1.3/KCNA3 => ECO:0000269|PubMed:26288216 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 27 type SITE sequence F description Important residue for binding Kv1.3/KCNA3 => ECO:0000269|PubMed:26288216 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 9 type SITE sequence K description Important residue for binding Kv1.3/KCNA3 => ECO:0000269|PubMed:8645244 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links