eF-site ID 1bz6-A
PDB Code 1bz6
Chain A

click to enlarge
Title ATOMIC RESOLUTION CRYSTAL STRUCTURE AQUOMET-MYOGLOBIN FROM SPERM WHALE AT ROOM TEMPERATURE
Classification OXYGEN STORAGE
Compound PROTEIN (MYOGLOBIN)
Source ORGANISM_COMMON: sperm whale; ORGANISM_SCIENTIFIC: Physeter catodon;
Sequence A:  VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETL
EKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG
HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP
GDFGADAQGAMNKALELFRKDIAAKYKELGYQG
Description (1)  MYOGLOBIN


Functional site

1) chain A
residue 58
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 201
source : AC1

2) chain A
residue 59
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 201
source : AC1

3) chain A
residue 60
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SO4 A 201
source : AC1

4) chain A
residue 120
type
ligand
sequence P
description BINDING SITE FOR RESIDUE SO4 A 202
source : AC2

5) chain A
residue 121
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 A 202
source : AC2

6) chain A
residue 122
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SO4 A 202
source : AC2

7) chain A
residue 45
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 203
source : AC3

8) chain A
residue 63
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 203
source : AC3

9) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 A 203
source : AC3

10) chain A
residue 67
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 A 203
source : AC3

11) chain A
residue 116
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 A 203
source : AC3

12) chain A
residue 31
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 204
source : AC4

13) chain A
residue 35
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 204
source : AC4

14) chain A
residue 96
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 204
source : AC4

15) chain A
residue 109
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 204
source : AC4

16) chain A
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

17) chain A
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

18) chain A
residue 45
type
ligand
sequence R
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

19) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

20) chain A
residue 67
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

21) chain A
residue 68
type
ligand
sequence V
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

22) chain A
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

23) chain A
residue 92
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

24) chain A
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

25) chain A
residue 97
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

26) chain A
residue 99
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

27) chain A
residue 103
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

28) chain A
residue 64
type METAL
ligand
sequence H
description Iron (heme distal ligand). {ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:845959}
source Swiss-Prot : SWS_FT_FI1

29) chain A
residue 93
type METAL
ligand
sequence H
description Iron (heme proximal ligand). {ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:845959}
source Swiss-Prot : SWS_FT_FI2

30) chain A
residue 32
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

31) chain A
residue 39
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence T
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

32) chain A
residue 42-43
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence KF
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

33) chain A
residue 45
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence R
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

34) chain A
residue 64
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

35) chain A
residue 67-68
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence TV
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

36) chain A
residue 71-72
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence AL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

37) chain A
residue 88-89
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence PL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

38) chain A
residue 92-93
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence SH
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

39) chain A
residue 97
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

40) chain A
residue 99
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

41) chain A
residue 103-104
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence YL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

42) chain A
residue 107
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

43) chain A
residue 111
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154

44) chain A
residue 138
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1bz6_A_154


Display surface

Download
Links