eF-site ID 1bxs-A PDB Code 1bxs Chain A click to enlarge Title SHEEP LIVER CLASS 1 ALDEHYDE DEHYDROGENASE WITH NAD BOUND Classification OXIDOREDUCTASE Compound ALDEHYDE DEHYDROGENASE Source ORGANISM_COMMON: sheep; ORGANISM_SCIENTIFIC: Ovis aries; Sequence A:  DVPAPLTNLQFKYTKIFINNEWHSSVSGKKFPVFNPATEE KLCEVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGR LLNKLADLIERDRLLLATMEAMNGGKLFSNAYLMDLGGCI KTLRYCAGWADKIQGRTIPMDGNFFTYTRSEPVGVCGQII PWNFPLLMFLWKIGPALSCGNTVVVKPAEQTPLTALHMGS LIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGS TEVGKLIKEAAGKSNLKRVSLELGGKSPCIVFADADLDNA VEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERA KKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAK LECGGGPWGNKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQ IMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVSSAL QSGTVWVNCYSVVSAQCPFGGFKMSGNGRELGEYGFHEYT EVKTVTIKISQKNS Description Functional site 1) chain A residue 165 type sequence I description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 2) chain A residue 166 type sequence I description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 3) chain A residue 167 type sequence P description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 4) chain A residue 168 type sequence W description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 5) chain A residue 169 type sequence N description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 6) chain A residue 192 type sequence K description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 7) chain A residue 194 type sequence A description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 8) chain A residue 195 type sequence E description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 9) chain A residue 225 type sequence G description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 10) chain A residue 226 type sequence P description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 11) chain A residue 229 type sequence G description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 12) chain A residue 230 type sequence A description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 13) chain A residue 243 type sequence F description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 14) chain A residue 245 type sequence G description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 15) chain A residue 246 type sequence S description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 16) chain A residue 249 type sequence V description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 17) chain A residue 253 type sequence I description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 18) chain A residue 269 type sequence L description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 19) chain A residue 270 type sequence G description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 20) chain A residue 302 type sequence C description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 21) chain A residue 349 type sequence Q description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 22) chain A residue 352 type sequence K description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 23) chain A residue 399 type sequence E description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 24) chain A residue 401 type sequence F description BINDING SITE FOR RESIDUE NAD A 550 source : AC1 25) chain A residue 269 type ACT_SITE sequence L description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU10007, ECO:0000255|PROSITE-ProRule:PRU10008 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 337 type MOD_RES sequence P description Phosphothreonine => ECO:0000250|UniProtKB:P00352 source Swiss-Prot : SWS_FT_FI8 27) chain A residue 295-306 type prosite sequence FYHQGQCCIAAS description ALDEHYDE_DEHYDR_CYS Aldehyde dehydrogenases cysteine active site. FyHQGQCCIAAS source prosite : PS00070 28) chain A residue 267-274 type prosite sequence LELGGKSP description ALDEHYDE_DEHYDR_GLU Aldehyde dehydrogenases glutamic acid active site. LELGGKSP source prosite : PS00687 29) chain A residue 413 type MOD_RES sequence L description Phosphoserine => ECO:0000250|UniProtKB:P00352 source Swiss-Prot : SWS_FT_FI9 30) chain A residue 170 type SITE sequence F description Transition state stabilizer => ECO:0000250|UniProtKB:P20000 source Swiss-Prot : SWS_FT_FI5 31) chain A residue 91 type MOD_RES sequence L description N6-acetyllysine => ECO:0000250|UniProtKB:P00352 source Swiss-Prot : SWS_FT_FI7 32) chain A residue 128 type MOD_RES sequence T description N6-acetyllysine => ECO:0000250|UniProtKB:P00352 source Swiss-Prot : SWS_FT_FI7 33) chain A residue 252 type MOD_RES sequence L description N6-acetyllysine => ECO:0000250|UniProtKB:P00352 source Swiss-Prot : SWS_FT_FI7 34) chain A residue 353 type MOD_RES sequence I description N6-acetyllysine => ECO:0000250|UniProtKB:P00352 source Swiss-Prot : SWS_FT_FI7 35) chain A residue 367 type MOD_RES sequence L description N6-acetyllysine => ECO:0000250|UniProtKB:P00352 source Swiss-Prot : SWS_FT_FI7 36) chain A residue 410 type MOD_RES sequence F description N6-acetyllysine => ECO:0000250|UniProtKB:P00352 source Swiss-Prot : SWS_FT_FI7 37) chain A residue 419 type MOD_RES sequence R description N6-acetyllysine => ECO:0000250|UniProtKB:P00352 source Swiss-Prot : SWS_FT_FI7 38) chain A residue 495 type MOD_RES sequence I description N6-acetyllysine => ECO:0000250|UniProtKB:P00352 source Swiss-Prot : SWS_FT_FI7 39) chain A residue 303 type ACT_SITE sequence I description Nucleophile => ECO:0000303|PubMed:9862807 source Swiss-Prot : SWS_FT_FI2 40) chain A residue 167 type BINDING sequence P description BINDING => ECO:0000269|PubMed:26373694, ECO:0000269|PubMed:9862807, ECO:0007744|PDB:1BXS, ECO:0007744|PDB:5AC0 source Swiss-Prot : SWS_FT_FI3 41) chain A residue 193 type BINDING sequence P description BINDING => ECO:0000269|PubMed:26373694, ECO:0000269|PubMed:9862807, ECO:0007744|PDB:1BXS, ECO:0007744|PDB:5AC0 source Swiss-Prot : SWS_FT_FI3 42) chain A residue 226 type BINDING sequence P description BINDING => ECO:0000269|PubMed:26373694, ECO:0000269|PubMed:9862807, ECO:0007744|PDB:1BXS, ECO:0007744|PDB:5AC0 source Swiss-Prot : SWS_FT_FI3 43) chain A residue 246 type BINDING sequence S description BINDING => ECO:0000269|PubMed:26373694, ECO:0000269|PubMed:9862807, ECO:0007744|PDB:1BXS, ECO:0007744|PDB:5AC0 source Swiss-Prot : SWS_FT_FI3 44) chain A residue 349 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:26373694, ECO:0000269|PubMed:9862807, ECO:0007744|PDB:1BXS, ECO:0007744|PDB:5AC0 source Swiss-Prot : SWS_FT_FI3 45) chain A residue 400 type BINDING sequence I description BINDING => ECO:0000269|PubMed:26373694, ECO:0000269|PubMed:9862807, ECO:0007744|PDB:1BXS, ECO:0007744|PDB:5AC0 source Swiss-Prot : SWS_FT_FI3 46) chain A residue 269 type BINDING sequence L description BINDING => ECO:0000269|PubMed:26373694, ECO:0007744|PDB:5AC0 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links