eF-site ID 1bj6_9-A PDB Code 1bj6 Model 9 Chain A click to enlarge Title 1H NMR OF (12-53) NCP7/D(ACGCC) COMPLEX, 10 STRUCTURES Classification Viral protein/DNA Compound DNA (5'-D(*AP*CP*GP*CP*C)-3') Source null (1BJ6) Sequence A:  NVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTE RQ Description Functional site 1) chain A residue 15 type sequence C description ZINC-BINDING SITES. source : ZNB 2) chain A residue 18 type sequence C description ZINC-BINDING SITES. source : ZNB 3) chain A residue 23 type sequence H description ZINC-BINDING SITES. source : ZNB 4) chain A residue 28 type sequence C description ZINC-BINDING SITES. source : ZNB 5) chain A residue 36 type sequence C description ZINC-BINDING SITES. source : ZNB 6) chain A residue 39 type sequence C description ZINC-BINDING SITES. source : ZNB 7) chain A residue 44 type sequence H description ZINC-BINDING SITES. source : ZNB 8) chain A residue 15 type sequence C description BINDING SITE FOR RESIDUE ZN A 54H source : AC1 9) chain A residue 18 type sequence C description BINDING SITE FOR RESIDUE ZN A 54H source : AC1 10) chain A residue 23 type sequence H description BINDING SITE FOR RESIDUE ZN A 54H source : AC1 11) chain A residue 28 type sequence C description BINDING SITE FOR RESIDUE ZN A 54H source : AC1 12) chain A residue 36 type sequence C description BINDING SITE FOR RESIDUE ZN A 55H source : AC2 13) chain A residue 39 type sequence C description BINDING SITE FOR RESIDUE ZN A 55H source : AC2 14) chain A residue 44 type sequence H description BINDING SITE FOR RESIDUE ZN A 55H source : AC2 15) chain A residue 49 type sequence C description BINDING SITE FOR RESIDUE ZN A 55H source : AC2

Display surface Download Links