eF-site ID 1beh-AB PDB Code 1beh Chain A, B click to enlarge Title HUMAN PHOSPHATIDYLETHANOLAMINE BINDING PROTEIN IN COMPLEX WITH CACODYLATE Classification LIPID BINDING PROTEIN Compound PHOSPHATIDYLETHANOLAMINE BINDING PROTEIN Source (PEBP_HUMAN) Sequence A:  VDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLT PTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYR EWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVW LVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRA PVAGTCYQAEWDDYVPKLYEQLSG B:  DLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTP TQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYRE WHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWL VYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAP VAGTCYQAEWDDYVPKLYEQLSG Description Functional site 1) chain A residue 70 type sequence D description BINDING SITE FOR RESIDUE CAC A 188 source : AC1 2) chain A residue 84 type sequence W description BINDING SITE FOR RESIDUE CAC A 188 source : AC1 3) chain A residue 86 type sequence H description BINDING SITE FOR RESIDUE CAC A 188 source : AC1 4) chain A residue 110 type sequence G description BINDING SITE FOR RESIDUE CAC A 188 source : AC1 5) chain A residue 111 type sequence P description BINDING SITE FOR RESIDUE CAC A 188 source : AC1 6) chain A residue 120 type sequence Y description BINDING SITE FOR RESIDUE CAC A 188 source : AC1 7) chain A residue 181 type sequence Y description BINDING SITE FOR RESIDUE CAC A 188 source : AC1 8) chain B residue 70 type sequence D description BINDING SITE FOR RESIDUE CAC B 188 source : AC2 9) chain B residue 84 type sequence W description BINDING SITE FOR RESIDUE CAC B 188 source : AC2 10) chain B residue 86 type sequence H description BINDING SITE FOR RESIDUE CAC B 188 source : AC2 11) chain B residue 110 type sequence G description BINDING SITE FOR RESIDUE CAC B 188 source : AC2 12) chain B residue 111 type sequence P description BINDING SITE FOR RESIDUE CAC B 188 source : AC2 13) chain B residue 118 type sequence H description BINDING SITE FOR RESIDUE CAC B 188 source : AC2 14) chain B residue 120 type sequence Y description BINDING SITE FOR RESIDUE CAC B 188 source : AC2 15) chain B residue 181 type sequence Y description BINDING SITE FOR RESIDUE CAC B 188 source : AC2 16) chain A residue 64-86 type prosite sequence YTLVLTDPDAPSRKDPKYREWHH description PBP Phosphatidylethanolamine-binding protein family signature. YtLVlTDPDaPSrkdpkyrewhH source prosite : PS01220 17) chain A residue 7 type MOD_RES sequence K description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 99 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 154 type MOD_RES sequence F description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI1 20) chain B residue 7 type MOD_RES sequence K description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI1 21) chain B residue 99 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI1 22) chain B residue 154 type MOD_RES sequence F description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 14 type MOD_RES sequence L description Phosphoserine => ECO:0000250|UniProtKB:P31044 source Swiss-Prot : SWS_FT_FI2 24) chain B residue 14 type MOD_RES sequence L description Phosphoserine => ECO:0000250|UniProtKB:P31044 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 43 type MOD_RES sequence P description Phosphothreonine => ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3 26) chain B residue 43 type MOD_RES sequence P description Phosphothreonine => ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3 27) chain A residue 53 type MOD_RES sequence I description Phosphoserine => ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI4 28) chain B residue 53 type MOD_RES sequence I description Phosphoserine => ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI4 29) chain A residue 55 type MOD_RES sequence W description Phosphoserine => ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI5 30) chain B residue 55 type MOD_RES sequence W description Phosphoserine => ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links