eF-site ID 1bdr-AB PDB Code 1bdr Chain A, B click to enlarge Title HIV-1 (2: 31, 33-37) PROTEASE COMPLEXED WITH INHIBITOR SB203386 Classification HYDROLASE Compound HIV-1 PROTEASE Source null (POL_HV1B5) Sequence A:  PQITLWQRPLVTIKIGGQLKEALLDTGADDSVVAGIELPG RWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT PVNIIGRNLLTQIGCTLNF B:  PQITLWQRPLVTIKIGGQLKEALLDTGADDSVVAGIELPG RWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT PVNIIGRNLLTQIGCTLNF Description Functional site 1) chain A residue 29 type sequence D description IM1 BINDING SITE. source : IM1 2) chain B residue 29 type sequence D description IM1 BINDING SITE. source : IM1 3) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 4) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 5) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 6) chain A residue 28 type sequence A description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 7) chain A residue 29 type sequence D description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 8) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 9) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 10) chain A residue 82 type sequence V description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 11) chain B residue 25 type sequence D description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 12) chain B residue 27 type sequence G description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 13) chain B residue 28 type sequence A description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 14) chain B residue 29 type sequence D description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 15) chain B residue 48 type sequence G description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 16) chain B residue 49 type sequence G description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 17) chain B residue 50 type sequence I description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 18) chain A residue 64 type SITE sequence I description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 19) chain B residue 64 type SITE sequence I description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 64 type MOD_RES sequence I description Phosphotyrosine; by host => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 21) chain B residue 64 type MOD_RES sequence I description Phosphotyrosine; by host => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 22-33 type prosite sequence ALLDTGADDSVV description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADDSVV source prosite : PS00141

Display surface Download Links