eF-site ID 1bdr-A PDB Code 1bdr Chain A click to enlarge Title HIV-1 (2: 31, 33-37) PROTEASE COMPLEXED WITH INHIBITOR SB203386 Classification HYDROLASE Compound HIV-1 PROTEASE Source Human immunodeficiency virus type 1 group M subtype B (isolate BH5) (HIV-1) (POL_HV1B5) Sequence A:  PQITLWQRPLVTIKIGGQLKEALLDTGADDSVVAGIELPG RWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT PVNIIGRNLLTQIGCTLNF Description Functional site 1) chain A residue 29 type sequence D description IM1 BINDING SITE. source : IM1 2) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 3) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 4) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 5) chain A residue 28 type sequence A description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 6) chain A residue 29 type sequence D description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 7) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 8) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 9) chain A residue 82 type sequence V description BINDING SITE FOR RESIDUE IM1 B 400 source : AC1 10) chain A residue 22-33 type prosite sequence ALLDTGADDSVV description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADDSVV source prosite : PS00141 11) chain A residue 64 type SITE sequence I description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 64 type MOD_RES sequence I description Phosphotyrosine; by host => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links