eF-site ID 1bc9-A
PDB Code 1bc9
Chain A

click to enlarge
Title CYTOHESIN-1/B2-1 SEC7 DOMAIN, NMR, MINIMIZED AVERAGE STRUCTURE
Classification EXCHANGE FACTOR
Compound CYTOHESIN-1
Source (CYH1_HUMAN)
Sequence A:  MKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCED
IAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEF
TDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCN
NGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIA
MNRGINDGGDLPEELLRNLYESIKNEPFKIPELEHHHHHH
Description (1)  CYTOHESIN-1

Display surface

Download
Links