eF-site ID 1b88-B
PDB Code 1b88
Chain B

click to enlarge
Title V-ALPHA 2.6 MOUSE T CELL RECEPTOR (TCR) DOMAIN
Classification IMMUNE SYSTEM
Compound T CELL RECEPTOR V-ALPHA DOMAIN
Source (U63546)
Sequence B:  MQQVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFP
GEGPALLISILSVSNKKEDGRFTIFFNKREKKLSLHIADS
QPGDSATYFCAASASFGDNSKLIWGLGTSLVVNP
Description (1)  T CELL RECEPTOR V-ALPHA DOMAIN

Display surface

Download
Links