eF-site ID 1b7v-A PDB Code 1b7v Chain A click to enlarge Title Structure of the C-553 cytochrome from Bacillus pasteruii to 1.7 A resolution Classification ELECTRON TRANSFER Compound PROTEIN (CYTOCHROME C-553) Source ORGANISM_SCIENTIFIC: Sporosarcina pasteurii; Sequence A:  VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEIL DIILNGQGGMPGGIAKGAEAEAVAAWLAEKK Description Functional site 1) chain A residue 25 type sequence E description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 2) chain A residue 31 type sequence K description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 3) chain A residue 32 type sequence C description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 4) chain A residue 35 type sequence C description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 5) chain A residue 36 type sequence H description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 6) chain A residue 45 type sequence A description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 7) chain A residue 46 type sequence P description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 8) chain A residue 47 type sequence A description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 9) chain A residue 48 type sequence I description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 10) chain A residue 55 type sequence Y description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 11) chain A residue 68 type sequence Q description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 12) chain A residue 70 type sequence G description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 13) chain A residue 71 type sequence M description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 14) chain A residue 75 type sequence I description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 15) chain A residue 78 type sequence G description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 16) chain A residue 82 type sequence E description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 17) chain A residue 88 type sequence L description BINDING SITE FOR RESIDUE HEC A 93 source : AC1 18) chain A residue 32 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 19) chain A residue 35 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 20) chain A residue 36 type BINDING sequence H description axial binding residue => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links