eF-site ID 1b3i-A PDB Code 1b3i Chain A click to enlarge Title NMR SOLUTION STRUCTURE OF PLASTOCYANIN FROM THE PHOTOSYNTHETIC PROKARYOTE, PROCHLOROTHRIX HOLLANDICA (MINIMIZED AVERAGE STRUCTURE) Classification ELECTRON TRANSPORT Compound PROTEIN (PLASTOCYANIN) Source null (PLAS_PROHO) Sequence A:  ASVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHN VIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSF YCTPHRGAGMVGTITVE Description Functional site 1) chain A residue 39 type sequence H description COPPER BINDING SITE source : CU 2) chain A residue 82 type sequence C description COPPER BINDING SITE source : CU 3) chain A residue 85 type sequence H description COPPER BINDING SITE source : CU 4) chain A residue 90 type sequence M description COPPER BINDING SITE source : CU 5) chain A residue 39 type sequence H description BINDING SITE FOR RESIDUE CU1 A 110 source : AC1 6) chain A residue 82 type sequence C description BINDING SITE FOR RESIDUE CU1 A 110 source : AC1 7) chain A residue 85 type sequence H description BINDING SITE FOR RESIDUE CU1 A 110 source : AC1 8) chain A residue 90 type sequence M description BINDING SITE FOR RESIDUE CU1 A 110 source : AC1 9) chain A residue 39 type catalytic sequence H description 278 source MCSA : MCSA1 10) chain A residue 82 type catalytic sequence C description 278 source MCSA : MCSA1 11) chain A residue 85 type catalytic sequence H description 278 source MCSA : MCSA1 12) chain A residue 90 type catalytic sequence M description 278 source MCSA : MCSA1 13) chain A residue 39 type BINDING sequence H description BINDING => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 82 type BINDING sequence C description BINDING => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 85 type BINDING sequence H description BINDING => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 90 type BINDING sequence M description BINDING => ECO:0000255|HAMAP-Rule:MF_00566 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 76-90 type prosite sequence GTYSFYCTPHRGAGM description COPPER_BLUE Type-1 copper (blue) proteins signature. GtyS.FYCt.P.HrgagM source prosite : PS00196

Display surface Download Links