eF-site ID 1b0v-A PDB Code 1b0v Chain A click to enlarge Title I40N MUTANT OF AZOTOBACTER VINELANDII FDI Classification ELECTRON TRANSPORT Compound PROTEIN (FERREDOXIN) Source null (FER1_AZOVI) Sequence A:  AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECN DCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPN ITEKKDPLPDAEDWDGVKGKLQHLER Description Functional site 1) chain A residue 2 type sequence F description BINDING SITE FOR RESIDUE SF4 A 107 source : AC1 2) chain A residue 20 type sequence C description BINDING SITE FOR RESIDUE SF4 A 107 source : AC1 3) chain A residue 22 type sequence V description BINDING SITE FOR RESIDUE SF4 A 107 source : AC1 4) chain A residue 24 type sequence C description BINDING SITE FOR RESIDUE SF4 A 107 source : AC1 5) chain A residue 25 type sequence F description BINDING SITE FOR RESIDUE SF4 A 107 source : AC1 6) chain A residue 39 type sequence C description BINDING SITE FOR RESIDUE SF4 A 107 source : AC1 7) chain A residue 40 type sequence N description BINDING SITE FOR RESIDUE SF4 A 107 source : AC1 8) chain A residue 42 type sequence C description BINDING SITE FOR RESIDUE SF4 A 107 source : AC1 9) chain A residue 43 type sequence A description BINDING SITE FOR RESIDUE SF4 A 107 source : AC1 10) chain A residue 45 type sequence C description BINDING SITE FOR RESIDUE SF4 A 107 source : AC1 11) chain A residue 8 type sequence C description BINDING SITE FOR RESIDUE F3S A 108 source : AC2 12) chain A residue 12 type sequence K description BINDING SITE FOR RESIDUE F3S A 108 source : AC2 13) chain A residue 13 type sequence Y description BINDING SITE FOR RESIDUE F3S A 108 source : AC2 14) chain A residue 14 type sequence T description BINDING SITE FOR RESIDUE F3S A 108 source : AC2 15) chain A residue 15 type sequence D description BINDING SITE FOR RESIDUE F3S A 108 source : AC2 16) chain A residue 16 type sequence C description BINDING SITE FOR RESIDUE F3S A 108 source : AC2 17) chain A residue 32 type sequence L description BINDING SITE FOR RESIDUE F3S A 108 source : AC2 18) chain A residue 49 type sequence C description BINDING SITE FOR RESIDUE F3S A 108 source : AC2 19) chain A residue 50 type sequence P description BINDING SITE FOR RESIDUE F3S A 108 source : AC2 20) chain A residue 54 type sequence I description BINDING SITE FOR RESIDUE F3S A 108 source : AC2 21) chain A residue 39-50 type prosite sequence CNDCALCEPECP description 4FE4S_FER_1 4Fe-4S ferredoxin-type iron-sulfur binding region signature. CnDCAlCEpECP source prosite : PS00198 22) chain A residue 9 type BINDING sequence I description BINDING => ECO:0000269|PubMed:3422475 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 17 type BINDING sequence V description BINDING => ECO:0000269|PubMed:3422475 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 21 type BINDING sequence P description BINDING => ECO:0000269|PubMed:3422475 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 40 type BINDING sequence N description BINDING => ECO:0000269|PubMed:3422475 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 43 type BINDING sequence A description BINDING => ECO:0000269|PubMed:3422475 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 46 type BINDING sequence E description BINDING => ECO:0000269|PubMed:3422475 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 50 type BINDING sequence P description BINDING => ECO:0000269|PubMed:3422475 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links