eF-site ID 1ayg_18-A PDB Code 1ayg Model 18 Chain A click to enlarge Title SOLUTION STRUCTURE OF CYTOCHROME C-552, NMR, 20 STRUCTURES Classification ELECTRON TRANSPORT Compound CYTOCHROME C-552 Source ORGANISM_SCIENTIFIC: Hydrogenobacter thermophilus; Sequence A:  NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVD YLAGKIKKGGSGVWGSVPMPPQNVTDAEAKQLAQWILSIK Description Functional site 1) chain A residue 9 type sequence G description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 2) chain A residue 10 type sequence C description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 3) chain A residue 13 type sequence C description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 4) chain A residue 14 type sequence H description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 5) chain A residue 23 type sequence P description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 6) chain A residue 32 type sequence Y description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 7) chain A residue 46 type sequence I description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 8) chain A residue 52 type sequence G description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 9) chain A residue 54 type sequence W description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 10) chain A residue 55 type sequence G description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 11) chain A residue 57 type sequence V description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 12) chain A residue 59 type sequence M description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 13) chain A residue 62 type sequence Q description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 14) chain A residue 72 type sequence L description BINDING SITE FOR RESIDUE HEC A 81 source : AC1 15) chain A residue 10 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 16) chain A residue 13 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 17) chain A residue 14 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 18) chain A residue 59 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links