eF-site ID 1as6-ABC PDB Code 1as6 Chain A, B, C click to enlarge Title STRUCTURE OF NITRITE BOUND TO OXIDIZED ALCALIGENES FAECALIS NITRITE REDUCTASE AT CRYO TEMPERATURE Classification OXIDOREDUCTASE Compound NITRITE REDUCTASE Source Alcaligenes faecalis (NIR_ALCFA) Sequence A:  TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMV IEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELT LINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRF KATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHD GKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYE DTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIV HSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIP GGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTG EWNDDLMTSVLAPSG B:  ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTM VIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLEL TLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILR FKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLH DGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAY EDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLI VHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFI PGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVT GEWNDDLMTSVLAPSG C:  TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMV IEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELT LINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRF KATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHD GKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYE DTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIV HSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIP GGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTG EWNDDLMTSVLAPSG Description Functional site 1) chain A residue 95 type sequence H description COPPER SITE. source : CU1 2) chain A residue 136 type sequence C description COPPER SITE. source : CU1 3) chain A residue 145 type sequence H description COPPER SITE. source : CU1 4) chain A residue 150 type sequence M description COPPER SITE. source : CU1 5) chain A residue 100 type sequence H description COPPER SITE. source : CU2 6) chain A residue 135 type sequence H description COPPER SITE. source : CU2 7) chain B residue 306 type sequence H description COPPER SITE. source : CU2 8) chain B residue 95 type sequence H description COPPER SITE. source : CU3 9) chain B residue 136 type sequence C description COPPER SITE. source : CU3 10) chain B residue 145 type sequence H description COPPER SITE. source : CU3 11) chain B residue 150 type sequence M description COPPER SITE. source : CU3 12) chain B residue 100 type sequence H description COPPER SITE. source : CU4 13) chain B residue 135 type sequence H description COPPER SITE. source : CU4 14) chain C residue 306 type sequence H description COPPER SITE. source : CU4 15) chain C residue 95 type sequence H description COPPER SITE. source : CU5 16) chain C residue 136 type sequence C description COPPER SITE. source : CU5 17) chain C residue 145 type sequence H description COPPER SITE. source : CU5 18) chain C residue 150 type sequence M description COPPER SITE. source : CU5 19) chain C residue 100 type sequence H description COPPER SITE. source : CU6 20) chain C residue 135 type sequence H description COPPER SITE. source : CU6 21) chain A residue 306 type sequence H description COPPER SITE. source : CU6 22) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE CU A 501 source : AC1 23) chain A residue 136 type sequence C description BINDING SITE FOR RESIDUE CU A 501 source : AC1 24) chain A residue 145 type sequence H description BINDING SITE FOR RESIDUE CU A 501 source : AC1 25) chain A residue 150 type sequence M description BINDING SITE FOR RESIDUE CU A 501 source : AC1 26) chain A residue 98 type sequence D description BINDING SITE FOR RESIDUE CU A 502 source : AC2 27) chain A residue 100 type sequence H description BINDING SITE FOR RESIDUE CU A 502 source : AC2 28) chain A residue 135 type sequence H description BINDING SITE FOR RESIDUE CU A 502 source : AC2 29) chain B residue 306 type sequence H description BINDING SITE FOR RESIDUE CU A 502 source : AC2 30) chain A residue 98 type sequence D description BINDING SITE FOR RESIDUE NO2 A 503 source : AC3 31) chain A residue 100 type sequence H description BINDING SITE FOR RESIDUE NO2 A 503 source : AC3 32) chain A residue 135 type sequence H description BINDING SITE FOR RESIDUE NO2 A 503 source : AC3 33) chain B residue 255 type sequence H description BINDING SITE FOR RESIDUE NO2 A 503 source : AC3 34) chain B residue 257 type sequence I description BINDING SITE FOR RESIDUE NO2 A 503 source : AC3 35) chain B residue 306 type sequence H description BINDING SITE FOR RESIDUE NO2 A 503 source : AC3 36) chain B residue 308 type sequence L description BINDING SITE FOR RESIDUE NO2 A 503 source : AC3 37) chain B residue 95 type sequence H description BINDING SITE FOR RESIDUE CU B 501 source : AC4 38) chain B residue 136 type sequence C description BINDING SITE FOR RESIDUE CU B 501 source : AC4 39) chain B residue 145 type sequence H description BINDING SITE FOR RESIDUE CU B 501 source : AC4 40) chain B residue 150 type sequence M description BINDING SITE FOR RESIDUE CU B 501 source : AC4 41) chain B residue 98 type sequence D description BINDING SITE FOR RESIDUE CU B 502 source : AC5 42) chain B residue 100 type sequence H description BINDING SITE FOR RESIDUE CU B 502 source : AC5 43) chain B residue 135 type sequence H description BINDING SITE FOR RESIDUE CU B 502 source : AC5 44) chain C residue 306 type sequence H description BINDING SITE FOR RESIDUE CU B 502 source : AC5 45) chain B residue 98 type sequence D description BINDING SITE FOR RESIDUE NO2 B 503 source : AC6 46) chain B residue 100 type sequence H description BINDING SITE FOR RESIDUE NO2 B 503 source : AC6 47) chain B residue 135 type sequence H description BINDING SITE FOR RESIDUE NO2 B 503 source : AC6 48) chain C residue 255 type sequence H description BINDING SITE FOR RESIDUE NO2 B 503 source : AC6 49) chain C residue 257 type sequence I description BINDING SITE FOR RESIDUE NO2 B 503 source : AC6 50) chain C residue 306 type sequence H description BINDING SITE FOR RESIDUE NO2 B 503 source : AC6 51) chain C residue 308 type sequence L description BINDING SITE FOR RESIDUE NO2 B 503 source : AC6 52) chain C residue 95 type sequence H description BINDING SITE FOR RESIDUE CU C 501 source : AC7 53) chain C residue 136 type sequence C description BINDING SITE FOR RESIDUE CU C 501 source : AC7 54) chain C residue 145 type sequence H description BINDING SITE FOR RESIDUE CU C 501 source : AC7 55) chain C residue 150 type sequence M description BINDING SITE FOR RESIDUE CU C 501 source : AC7 56) chain A residue 306 type sequence H description BINDING SITE FOR RESIDUE CU C 502 source : AC8 57) chain C residue 98 type sequence D description BINDING SITE FOR RESIDUE CU C 502 source : AC8 58) chain C residue 100 type sequence H description BINDING SITE FOR RESIDUE CU C 502 source : AC8 59) chain C residue 135 type sequence H description BINDING SITE FOR RESIDUE CU C 502 source : AC8 60) chain A residue 255 type sequence H description BINDING SITE FOR RESIDUE NO2 C 503 source : AC9 61) chain A residue 257 type sequence I description BINDING SITE FOR RESIDUE NO2 C 503 source : AC9 62) chain A residue 306 type sequence H description BINDING SITE FOR RESIDUE NO2 C 503 source : AC9 63) chain A residue 308 type sequence L description BINDING SITE FOR RESIDUE NO2 C 503 source : AC9 64) chain C residue 98 type sequence D description BINDING SITE FOR RESIDUE NO2 C 503 source : AC9 65) chain C residue 100 type sequence H description BINDING SITE FOR RESIDUE NO2 C 503 source : AC9 66) chain C residue 135 type sequence H description BINDING SITE FOR RESIDUE NO2 C 503 source : AC9 67) chain A residue 95 type BINDING sequence H description type 1 copper site => ECO:0000269|PubMed:8172899 source Swiss-Prot : SWS_FT_FI1 68) chain B residue 95 type BINDING sequence H description type 1 copper site => ECO:0000269|PubMed:8172899 source Swiss-Prot : SWS_FT_FI1 69) chain C residue 95 type BINDING sequence H description type 1 copper site => ECO:0000269|PubMed:8172899 source Swiss-Prot : SWS_FT_FI1 70) chain A residue 100 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 71) chain A residue 135 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 72) chain B residue 100 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 73) chain B residue 135 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 74) chain C residue 100 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 75) chain C residue 135 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 76) chain A residue 136 type BINDING sequence C description type 1 copper site source Swiss-Prot : SWS_FT_FI3 77) chain A residue 145 type BINDING sequence H description type 1 copper site source Swiss-Prot : SWS_FT_FI3 78) chain A residue 150 type BINDING sequence M description type 1 copper site source Swiss-Prot : SWS_FT_FI3 79) chain B residue 136 type BINDING sequence C description type 1 copper site source Swiss-Prot : SWS_FT_FI3 80) chain B residue 145 type BINDING sequence H description type 1 copper site source Swiss-Prot : SWS_FT_FI3 81) chain B residue 150 type BINDING sequence M description type 1 copper site source Swiss-Prot : SWS_FT_FI3 82) chain C residue 136 type BINDING sequence C description type 1 copper site source Swiss-Prot : SWS_FT_FI3 83) chain C residue 145 type BINDING sequence H description type 1 copper site source Swiss-Prot : SWS_FT_FI3 84) chain C residue 150 type BINDING sequence M description type 1 copper site source Swiss-Prot : SWS_FT_FI3 85) chain A residue 306 type BINDING sequence H description type 2 copper site => ECO:0000269|PubMed:8172899 source Swiss-Prot : SWS_FT_FI4 86) chain B residue 306 type BINDING sequence H description type 2 copper site => ECO:0000269|PubMed:8172899 source Swiss-Prot : SWS_FT_FI4 87) chain C residue 306 type BINDING sequence H description type 2 copper site => ECO:0000269|PubMed:8172899 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links