eF-site ID 1as6-ABC
PDB Code 1as6
Chain A, B, C

click to enlarge
Title STRUCTURE OF NITRITE BOUND TO OXIDIZED ALCALIGENES FAECALIS NITRITE REDUCTASE AT CRYO TEMPERATURE
Classification OXIDOREDUCTASE
Compound NITRITE REDUCTASE
Source Alcaligenes faecalis (NIR_ALCFA)
Sequence A:  TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMV
IEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELT
LINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRF
KATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHD
GKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYE
DTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIV
HSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIP
GGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTG
EWNDDLMTSVLAPSG
B:  ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTM
VIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLEL
TLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILR
FKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLH
DGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAY
EDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLI
VHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFI
PGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVT
GEWNDDLMTSVLAPSG
C:  TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMV
IEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELT
LINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRF
KATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHD
GKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYE
DTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIV
HSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIP
GGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTG
EWNDDLMTSVLAPSG
Description (1)  NITRITE REDUCTASE


Functional site

1) chain A
residue 95
type
ligand
sequence H
description COPPER SITE.
source : CU1

2) chain A
residue 136
type
ligand
sequence C
description COPPER SITE.
source : CU1

3) chain A
residue 145
type
ligand
sequence H
description COPPER SITE.
source : CU1

4) chain A
residue 150
type
ligand
sequence M
description COPPER SITE.
source : CU1

5) chain A
residue 100
type
ligand
sequence H
description COPPER SITE.
source : CU2

6) chain A
residue 135
type
ligand
sequence H
description COPPER SITE.
source : CU2

7) chain B
residue 306
type
ligand
sequence H
description COPPER SITE.
source : CU2

8) chain B
residue 95
type
ligand
sequence H
description COPPER SITE.
source : CU3

9) chain B
residue 136
type
ligand
sequence C
description COPPER SITE.
source : CU3

10) chain B
residue 145
type
ligand
sequence H
description COPPER SITE.
source : CU3

11) chain B
residue 150
type
ligand
sequence M
description COPPER SITE.
source : CU3

12) chain B
residue 100
type
ligand
sequence H
description COPPER SITE.
source : CU4

13) chain B
residue 135
type
ligand
sequence H
description COPPER SITE.
source : CU4

14) chain C
residue 306
type
ligand
sequence H
description COPPER SITE.
source : CU4

15) chain C
residue 95
type
ligand
sequence H
description COPPER SITE.
source : CU5

16) chain C
residue 136
type
ligand
sequence C
description COPPER SITE.
source : CU5

17) chain C
residue 145
type
ligand
sequence H
description COPPER SITE.
source : CU5

18) chain C
residue 150
type
ligand
sequence M
description COPPER SITE.
source : CU5

19) chain C
residue 100
type
ligand
sequence H
description COPPER SITE.
source : CU6

20) chain C
residue 135
type
ligand
sequence H
description COPPER SITE.
source : CU6

21) chain A
residue 306
type
ligand
sequence H
description COPPER SITE.
source : CU6

22) chain A
residue 95
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU A 501
source : AC1

23) chain A
residue 136
type
ligand
sequence C
description BINDING SITE FOR RESIDUE CU A 501
source : AC1

24) chain A
residue 145
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU A 501
source : AC1

25) chain A
residue 150
type
ligand
sequence M
description BINDING SITE FOR RESIDUE CU A 501
source : AC1

26) chain A
residue 98
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CU A 502
source : AC2

27) chain A
residue 100
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU A 502
source : AC2

28) chain A
residue 135
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU A 502
source : AC2

29) chain B
residue 306
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU A 502
source : AC2

30) chain A
residue 98
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NO2 A 503
source : AC3

31) chain A
residue 100
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NO2 A 503
source : AC3

32) chain A
residue 135
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NO2 A 503
source : AC3

33) chain B
residue 255
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NO2 A 503
source : AC3

34) chain B
residue 257
type
ligand
sequence I
description BINDING SITE FOR RESIDUE NO2 A 503
source : AC3

35) chain B
residue 306
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NO2 A 503
source : AC3

36) chain B
residue 308
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NO2 A 503
source : AC3

37) chain B
residue 95
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU B 501
source : AC4

38) chain B
residue 136
type
ligand
sequence C
description BINDING SITE FOR RESIDUE CU B 501
source : AC4

39) chain B
residue 145
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU B 501
source : AC4

40) chain B
residue 150
type
ligand
sequence M
description BINDING SITE FOR RESIDUE CU B 501
source : AC4

41) chain B
residue 98
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CU B 502
source : AC5

42) chain B
residue 100
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU B 502
source : AC5

43) chain B
residue 135
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU B 502
source : AC5

44) chain C
residue 306
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU B 502
source : AC5

45) chain B
residue 98
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NO2 B 503
source : AC6

46) chain B
residue 100
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NO2 B 503
source : AC6

47) chain B
residue 135
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NO2 B 503
source : AC6

48) chain C
residue 255
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NO2 B 503
source : AC6

49) chain C
residue 257
type
ligand
sequence I
description BINDING SITE FOR RESIDUE NO2 B 503
source : AC6

50) chain C
residue 306
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NO2 B 503
source : AC6

51) chain C
residue 308
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NO2 B 503
source : AC6

52) chain C
residue 95
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU C 501
source : AC7

53) chain C
residue 136
type
ligand
sequence C
description BINDING SITE FOR RESIDUE CU C 501
source : AC7

54) chain C
residue 145
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU C 501
source : AC7

55) chain C
residue 150
type
ligand
sequence M
description BINDING SITE FOR RESIDUE CU C 501
source : AC7

56) chain A
residue 306
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU C 502
source : AC8

57) chain C
residue 98
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CU C 502
source : AC8

58) chain C
residue 100
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU C 502
source : AC8

59) chain C
residue 135
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CU C 502
source : AC8

60) chain A
residue 255
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NO2 C 503
source : AC9

61) chain A
residue 257
type
ligand
sequence I
description BINDING SITE FOR RESIDUE NO2 C 503
source : AC9

62) chain A
residue 306
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NO2 C 503
source : AC9

63) chain A
residue 308
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NO2 C 503
source : AC9

64) chain C
residue 98
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NO2 C 503
source : AC9

65) chain C
residue 100
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NO2 C 503
source : AC9

66) chain C
residue 135
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NO2 C 503
source : AC9

67) chain A
residue 103
type METAL
ligand
sequence T
description Copper 2; type 2
source Swiss-Prot : SWS_FT_FI1

68) chain A
residue 138
type METAL
ligand
sequence P
description Copper 2; type 2
source Swiss-Prot : SWS_FT_FI1

69) chain A
residue 309
type METAL
ligand
sequence I
description Copper 2; type 2
source Swiss-Prot : SWS_FT_FI1

70) chain A
residue 98
type METAL
ligand
sequence D
description Copper 1; type 1
source Swiss-Prot : SWS_FT_FI2

71) chain A
residue 139
type METAL
ligand
sequence P
description Copper 1; type 1
source Swiss-Prot : SWS_FT_FI2

72) chain A
residue 148
type METAL
ligand
sequence S
description Copper 1; type 1
source Swiss-Prot : SWS_FT_FI2

73) chain A
residue 153
type METAL
ligand
sequence A
description Copper 1; type 1
source Swiss-Prot : SWS_FT_FI2

74) chain B
residue 103
type METAL
ligand
sequence T
description Copper 2; type 2
source Swiss-Prot : SWS_FT_FI3

75) chain B
residue 138
type METAL
ligand
sequence P
description Copper 2; type 2
source Swiss-Prot : SWS_FT_FI3

76) chain B
residue 309
type METAL
ligand
sequence I
description Copper 2; type 2
source Swiss-Prot : SWS_FT_FI3

77) chain B
residue 98
type METAL
ligand
sequence D
description Copper 1; type 1
source Swiss-Prot : SWS_FT_FI4

78) chain B
residue 139
type METAL
ligand
sequence P
description Copper 1; type 1
source Swiss-Prot : SWS_FT_FI4

79) chain B
residue 148
type METAL
ligand
sequence S
description Copper 1; type 1
source Swiss-Prot : SWS_FT_FI4

80) chain B
residue 153
type METAL
ligand
sequence A
description Copper 1; type 1
source Swiss-Prot : SWS_FT_FI4

81) chain C
residue 103
type METAL
ligand
sequence T
description Copper 2; type 2
source Swiss-Prot : SWS_FT_FI5

82) chain C
residue 138
type METAL
ligand
sequence P
description Copper 2; type 2
source Swiss-Prot : SWS_FT_FI5

83) chain C
residue 309
type METAL
ligand
sequence I
description Copper 2; type 2
source Swiss-Prot : SWS_FT_FI5

84) chain C
residue 98
type METAL
ligand
sequence D
description Copper 1; type 1
source Swiss-Prot : SWS_FT_FI6

85) chain C
residue 139
type METAL
ligand
sequence P
description Copper 1; type 1
source Swiss-Prot : SWS_FT_FI6

86) chain C
residue 148
type METAL
ligand
sequence S
description Copper 1; type 1
source Swiss-Prot : SWS_FT_FI6

87) chain C
residue 153
type METAL
ligand
sequence A
description Copper 1; type 1
source Swiss-Prot : SWS_FT_FI6

88) chain A
residue 98
type catalytic
ligand
sequence D
description Mapped from 1nid to 1as6 using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 10811642, 98019216, 98407981
source extCATRES : extCATRES1

89) chain C
residue 255
type catalytic
ligand
sequence H
description Mapped from 1nid to 1as6 using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 10811642, 98019216, 98407981
source extCATRES : extCATRES1

90) chain A
residue 98
type binding
ligand NO2: NITRITE ION
sequence D
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_A_503

91) chain A
residue 100
type binding
ligand NO2: NITRITE ION
sequence H
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_A_503

92) chain A
residue 135
type binding
ligand NO2: NITRITE ION
sequence H
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_A_503

93) chain A
residue 142
type binding
ligand NO2: NITRITE ION
sequence V
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_A_503

94) chain B
residue 255
type binding
ligand NO2: NITRITE ION
sequence H
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_A_503

95) chain B
residue 257-258
type binding
ligand NO2: NITRITE ION
sequence IG
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_A_503

96) chain B
residue 304
type binding
ligand NO2: NITRITE ION
sequence V
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_A_503

97) chain B
residue 306
type binding
ligand NO2: NITRITE ION
sequence H
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_A_503

98) chain B
residue 308
type binding
ligand NO2: NITRITE ION
sequence L
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_A_503

99) chain A
residue 255
type binding
ligand NO2: NITRITE ION
sequence H
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_C_503

100) chain A
residue 257-258
type binding
ligand NO2: NITRITE ION
sequence IG
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_C_503

101) chain A
residue 304
type binding
ligand NO2: NITRITE ION
sequence V
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_C_503

102) chain A
residue 306
type binding
ligand NO2: NITRITE ION
sequence H
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_C_503

103) chain A
residue 308
type binding
ligand NO2: NITRITE ION
sequence L
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_C_503

104) chain C
residue 98
type binding
ligand NO2: NITRITE ION
sequence D
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_C_503

105) chain C
residue 100
type binding
ligand NO2: NITRITE ION
sequence H
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_C_503

106) chain C
residue 135
type binding
ligand NO2: NITRITE ION
sequence H
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_C_503

107) chain C
residue 142
type binding
ligand NO2: NITRITE ION
sequence V
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_C_503

108) chain B
residue 98
type binding
ligand NO2: NITRITE ION
sequence D
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_B_503

109) chain B
residue 100
type binding
ligand NO2: NITRITE ION
sequence H
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_B_503

110) chain B
residue 135
type binding
ligand NO2: NITRITE ION
sequence H
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_B_503

111) chain B
residue 142
type binding
ligand NO2: NITRITE ION
sequence V
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_B_503

112) chain C
residue 255
type binding
ligand NO2: NITRITE ION
sequence H
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_B_503

113) chain C
residue 257-258
type binding
ligand NO2: NITRITE ION
sequence IG
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_B_503

114) chain C
residue 304
type binding
ligand NO2: NITRITE ION
sequence V
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_B_503

115) chain C
residue 306
type binding
ligand NO2: NITRITE ION
sequence H
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_B_503

116) chain C
residue 308
type binding
ligand NO2: NITRITE ION
sequence L
description NITRITE ION binding site
source pdb_hetatom : NO2_1as6_B_503

117) chain A
residue 64
type catalytic
ligand
sequence F
description Annotated By Reference To The Literature 1nid
source CSA : CSA1

118) chain A
residue 66
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1nid
source CSA : CSA1

119) chain B
residue 64
type catalytic
ligand
sequence F
description Annotated By Reference To The Literature 1nid
source CSA : CSA2

120) chain B
residue 66
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1nid
source CSA : CSA2

121) chain C
residue 64
type catalytic
ligand
sequence F
description Annotated By Reference To The Literature 1nid
source CSA : CSA3

122) chain C
residue 66
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1nid
source CSA : CSA3

123) chain A
residue 98
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1nid
source CSA : CSA4

124) chain A
residue 255
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1nid
source CSA : CSA4

125) chain B
residue 98
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1nid
source CSA : CSA5

126) chain B
residue 255
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1nid
source CSA : CSA5

127) chain C
residue 98
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1nid
source CSA : CSA6

128) chain C
residue 255
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1nid
source CSA : CSA6


Display surface

Download
Links