eF-site ID 1aiy_6-J
PDB Code 1aiy
Model 6
Chain J

click to enlarge
Title R6 HUMAN INSULIN HEXAMER (SYMMETRIC), NMR, 10 STRUCTURES
Classification HORMONE
Compound R6 INSULIN HEXAMER
Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens;
Sequence J:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  R6 INSULIN HEXAMER, PHENOL


Functional site

1) chain J
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

2) chain J
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

3) chain J
residue 14
type binding
ligand IPH: PHENOL
sequence A
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

4) chain J
residue 13
type binding
ligand IPH: PHENOL
sequence E
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

5) chain J
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

6) chain J
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

7) chain J
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

8) chain J
residue 13-14
type binding
ligand IPH: PHENOL
sequence EA
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

9) chain J
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

10) chain J
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

11) chain J
residue 13-15
type binding
ligand IPH: PHENOL
sequence EAL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

12) chain J
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

13) chain J
residue 6
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

14) chain J
residue 10
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

15) chain J
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

16) chain J
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

17) chain J
residue 9
type binding
ligand IPH: PHENOL
sequence S
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32


Display surface

Download
Links