eF-site ID 1aiy_6-D
PDB Code 1aiy
Model 6
Chain D

click to enlarge
Title R6 HUMAN INSULIN HEXAMER (SYMMETRIC), NMR, 10 STRUCTURES
Classification HORMONE
Compound R6 INSULIN HEXAMER
Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens;
Sequence D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  R6 INSULIN HEXAMER, PHENOL


Functional site

1) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 31
source : AC3

2) chain D
residue 7
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH D 32
source : AC4

3) chain D
residue 2
type
ligand
sequence V
description BINDING SITE FOR RESIDUE IPH H 31
source : AC6

4) chain D
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE IPH H 31
source : AC6

5) chain D
residue 6
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH H 31
source : AC6

6) chain D
residue 17
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH J 31
source : AC7

7) chain D
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

8) chain D
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

9) chain D
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

10) chain D
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

11) chain D
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

12) chain D
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

13) chain D
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

14) chain D
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

15) chain D
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

16) chain D
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

17) chain D
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33

18) chain D
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33

19) chain D
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

20) chain D
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

21) chain D
residue 13-17
type binding
ligand IPH: PHENOL
sequence EALYL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

22) chain D
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

23) chain D
residue 6
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

24) chain D
residue 10
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

25) chain D
residue 9
type binding
ligand ZN: ZINC ION
sequence S
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

26) chain D
residue 7
type binding
ligand ZN: ZINC ION
sequence C
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31


Display surface

Download
Links