eF-site ID 1aiy_5-J
PDB Code 1aiy
Model 5
Chain J

click to enlarge
Title R6 HUMAN INSULIN HEXAMER (SYMMETRIC), NMR, 10 STRUCTURES
Classification HORMONE
Compound R6 INSULIN HEXAMER
Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens;
Sequence J:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  R6 INSULIN HEXAMER, PHENOL

Display surface

Download
Links