eF-site ID 1aiy_5-ABCDEFGHIJKL
PDB Code 1aiy
Model 5
Chain A, B, C, D, E, F, G, H, I, J, K, L

click to enlarge
Title R6 HUMAN INSULIN HEXAMER (SYMMETRIC), NMR, 10 STRUCTURES
Classification HORMONE
Compound R6 INSULIN HEXAMER
Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens;
Sequence A:  GIVEQCCTSICSLYQLENYCN
B:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
C:  GIVEQCCTSICSLYQLENYCN
D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
E:  GIVEQCCTSICSLYQLENYCN
F:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
G:  GIVEQCCTSICSLYQLENYCN
H:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
I:  GIVEQCCTSICSLYQLENYCN
J:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
K:  GIVEQCCTSICSLYQLENYCN
L:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  R6 INSULIN HEXAMER, PHENOL


Functional site

1) chain B
residue 6
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ZN B 31
source : AC1

2) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 31
source : AC1

3) chain F
residue 6
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ZN B 31
source : AC1

4) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 31
source : AC1

5) chain A
residue 5
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE IPH B 32
source : AC2

6) chain A
residue 6
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH B 32
source : AC2

7) chain A
residue 11
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH B 32
source : AC2

8) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE IPH B 32
source : AC2

9) chain B
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH B 32
source : AC2

10) chain B
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE IPH B 32
source : AC2

11) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 31
source : AC3

12) chain C
residue 5
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE IPH D 32
source : AC4

13) chain C
residue 6
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH D 32
source : AC4

14) chain C
residue 7
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH D 32
source : AC4

15) chain C
residue 10
type
ligand
sequence I
description BINDING SITE FOR RESIDUE IPH D 32
source : AC4

16) chain C
residue 11
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH D 32
source : AC4

17) chain C
residue 16
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH D 32
source : AC4

18) chain D
residue 7
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH D 32
source : AC4

19) chain E
residue 6
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH F 32
source : AC5

20) chain E
residue 7
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH F 32
source : AC5

21) chain E
residue 9
type
ligand
sequence S
description BINDING SITE FOR RESIDUE IPH F 32
source : AC5

22) chain E
residue 10
type
ligand
sequence I
description BINDING SITE FOR RESIDUE IPH F 32
source : AC5

23) chain E
residue 11
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH F 32
source : AC5

24) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE IPH F 32
source : AC5

25) chain D
residue 2
type
ligand
sequence V
description BINDING SITE FOR RESIDUE IPH H 31
source : AC6

26) chain D
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE IPH H 31
source : AC6

27) chain D
residue 6
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH H 31
source : AC6

28) chain G
residue 2
type
ligand
sequence I
description BINDING SITE FOR RESIDUE IPH H 31
source : AC6

29) chain G
residue 11
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH H 31
source : AC6

30) chain H
residue 7
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH H 31
source : AC6

31) chain B
residue 2
type
ligand
sequence V
description BINDING SITE FOR RESIDUE IPH J 31
source : AC7

32) chain B
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE IPH J 31
source : AC7

33) chain B
residue 6
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH J 31
source : AC7

34) chain D
residue 17
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH J 31
source : AC7

35) chain I
residue 6
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH J 31
source : AC7

36) chain I
residue 10
type
ligand
sequence I
description BINDING SITE FOR RESIDUE IPH J 31
source : AC7

37) chain I
residue 11
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH J 31
source : AC7

38) chain F
residue 17
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH L 31
source : AC8

39) chain H
residue 2
type
ligand
sequence V
description BINDING SITE FOR RESIDUE IPH L 31
source : AC8

40) chain H
residue 6
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH L 31
source : AC8

41) chain K
residue 5
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE IPH L 31
source : AC8

42) chain K
residue 6
type
ligand
sequence C
description BINDING SITE FOR RESIDUE IPH L 31
source : AC8

43) chain K
residue 9
type
ligand
sequence S
description BINDING SITE FOR RESIDUE IPH L 31
source : AC8

44) chain A
residue 2
type binding
ligand IPH: PHENOL
sequence I
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

45) chain A
residue 6-7
type binding
ligand IPH: PHENOL
sequence CC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

46) chain A
residue 9-13
type binding
ligand IPH: PHENOL
sequence SICSL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

47) chain A
residue 15-16
type binding
ligand IPH: PHENOL
sequence QL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

48) chain B
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

49) chain B
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

50) chain B
residue 13-15
type binding
ligand IPH: PHENOL
sequence EAL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

51) chain B
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

52) chain F
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

53) chain F
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

54) chain H
residue 16-17
type binding
ligand IPH: PHENOL
sequence YL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

55) chain A
residue 5
type binding
ligand IPH: PHENOL
sequence Q
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

56) chain A
residue 8
type binding
ligand IPH: PHENOL
sequence T
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

57) chain B
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

58) chain B
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

59) chain D
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

60) chain I
residue 2
type binding
ligand IPH: PHENOL
sequence I
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

61) chain I
residue 6-7
type binding
ligand IPH: PHENOL
sequence CC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

62) chain I
residue 9-11
type binding
ligand IPH: PHENOL
sequence SIC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

63) chain I
residue 16
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

64) chain J
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

65) chain J
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

66) chain J
residue 14
type binding
ligand IPH: PHENOL
sequence A
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

67) chain J
residue 13
type binding
ligand IPH: PHENOL
sequence E
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

68) chain J
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

69) chain D
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

70) chain I
residue 5
type binding
ligand IPH: PHENOL
sequence Q
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

71) chain I
residue 8
type binding
ligand IPH: PHENOL
sequence T
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

72) chain B
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

73) chain B
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

74) chain D
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

75) chain I
residue 6-7
type binding
ligand IPH: PHENOL
sequence CC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

76) chain I
residue 9-11
type binding
ligand IPH: PHENOL
sequence SIC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

77) chain I
residue 16
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

78) chain J
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

79) chain J
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

80) chain J
residue 13-14
type binding
ligand IPH: PHENOL
sequence EA
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

81) chain I
residue 5
type binding
ligand IPH: PHENOL
sequence Q
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

82) chain D
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

83) chain I
residue 8
type binding
ligand IPH: PHENOL
sequence T
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

84) chain B
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

85) chain B
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

86) chain D
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

87) chain I
residue 2
type binding
ligand IPH: PHENOL
sequence I
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

88) chain I
residue 6-7
type binding
ligand IPH: PHENOL
sequence CC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

89) chain I
residue 9-12
type binding
ligand IPH: PHENOL
sequence SICS
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

90) chain I
residue 16
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

91) chain J
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

92) chain J
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

93) chain J
residue 13-15
type binding
ligand IPH: PHENOL
sequence EAL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

94) chain I
residue 13
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

95) chain J
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

96) chain D
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

97) chain I
residue 5
type binding
ligand IPH: PHENOL
sequence Q
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

98) chain I
residue 8
type binding
ligand IPH: PHENOL
sequence T
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

99) chain B
residue 6
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

100) chain B
residue 10
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

101) chain F
residue 6
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

102) chain F
residue 10
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

103) chain J
residue 6
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

104) chain J
residue 10
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

105) chain B
residue 9
type binding
ligand ZN: ZINC ION
sequence S
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

106) chain F
residue 9
type binding
ligand ZN: ZINC ION
sequence S
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

107) chain B
residue 16-17
type binding
ligand IPH: PHENOL
sequence YL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

108) chain D
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

109) chain D
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

110) chain G
residue 2
type binding
ligand IPH: PHENOL
sequence I
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

111) chain G
residue 6-7
type binding
ligand IPH: PHENOL
sequence CC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

112) chain G
residue 9-13
type binding
ligand IPH: PHENOL
sequence SICSL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

113) chain G
residue 15-16
type binding
ligand IPH: PHENOL
sequence QL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

114) chain H
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

115) chain H
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

116) chain H
residue 14-15
type binding
ligand IPH: PHENOL
sequence AL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

117) chain H
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

118) chain H
residue 13
type binding
ligand IPH: PHENOL
sequence E
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

119) chain G
residue 5
type binding
ligand IPH: PHENOL
sequence Q
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

120) chain G
residue 8
type binding
ligand IPH: PHENOL
sequence T
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

121) chain B
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

122) chain D
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

123) chain D
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

124) chain G
residue 2
type binding
ligand IPH: PHENOL
sequence I
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

125) chain G
residue 6-7
type binding
ligand IPH: PHENOL
sequence CC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

126) chain G
residue 9-11
type binding
ligand IPH: PHENOL
sequence SIC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

127) chain G
residue 16
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

128) chain H
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

129) chain H
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

130) chain H
residue 14
type binding
ligand IPH: PHENOL
sequence A
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

131) chain H
residue 13
type binding
ligand IPH: PHENOL
sequence E
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

132) chain H
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

133) chain B
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

134) chain G
residue 5
type binding
ligand IPH: PHENOL
sequence Q
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

135) chain G
residue 8
type binding
ligand IPH: PHENOL
sequence T
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

136) chain B
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33

137) chain D
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33

138) chain D
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33

139) chain G
residue 6-7
type binding
ligand IPH: PHENOL
sequence CC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33

140) chain G
residue 9-11
type binding
ligand IPH: PHENOL
sequence SIC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33

141) chain G
residue 16
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33

142) chain H
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33

143) chain H
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33

144) chain H
residue 13-14
type binding
ligand IPH: PHENOL
sequence EA
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33

145) chain B
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33

146) chain C
residue 2
type binding
ligand IPH: PHENOL
sequence I
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

147) chain C
residue 6-7
type binding
ligand IPH: PHENOL
sequence CC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

148) chain C
residue 9-12
type binding
ligand IPH: PHENOL
sequence SICS
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

149) chain C
residue 16
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

150) chain D
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

151) chain D
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

152) chain D
residue 13-17
type binding
ligand IPH: PHENOL
sequence EALYL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

153) chain L
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

154) chain L
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

155) chain C
residue 13
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

156) chain D
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

157) chain C
residue 5
type binding
ligand IPH: PHENOL
sequence Q
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

158) chain C
residue 8
type binding
ligand IPH: PHENOL
sequence T
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

159) chain C
residue 19
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

160) chain D
residue 6
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

161) chain D
residue 10
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

162) chain H
residue 6
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

163) chain H
residue 10
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

164) chain L
residue 6
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

165) chain L
residue 10
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

166) chain D
residue 9
type binding
ligand ZN: ZINC ION
sequence S
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

167) chain H
residue 13
type binding
ligand ZN: ZINC ION
sequence E
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

168) chain H
residue 9
type binding
ligand ZN: ZINC ION
sequence S
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

169) chain L
residue 9
type binding
ligand ZN: ZINC ION
sequence S
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

170) chain L
residue 13
type binding
ligand ZN: ZINC ION
sequence E
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

171) chain D
residue 7
type binding
ligand ZN: ZINC ION
sequence C
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

172) chain E
residue 2
type binding
ligand IPH: PHENOL
sequence I
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

173) chain E
residue 6-7
type binding
ligand IPH: PHENOL
sequence CC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

174) chain E
residue 9-13
type binding
ligand IPH: PHENOL
sequence SICSL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

175) chain E
residue 16
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

176) chain F
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

177) chain F
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

178) chain F
residue 13-14
type binding
ligand IPH: PHENOL
sequence EA
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

179) chain F
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

180) chain J
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

181) chain J
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

182) chain L
residue 16-17
type binding
ligand IPH: PHENOL
sequence YL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

183) chain F
residue 15
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

184) chain J
residue 9
type binding
ligand IPH: PHENOL
sequence S
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

185) chain E
residue 5
type binding
ligand IPH: PHENOL
sequence Q
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

186) chain E
residue 8
type binding
ligand IPH: PHENOL
sequence T
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

187) chain F
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

188) chain H
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

189) chain H
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

190) chain K
residue 2
type binding
ligand IPH: PHENOL
sequence I
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

191) chain K
residue 6-7
type binding
ligand IPH: PHENOL
sequence CC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

192) chain K
residue 9-11
type binding
ligand IPH: PHENOL
sequence SIC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

193) chain K
residue 16
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

194) chain L
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

195) chain L
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

196) chain L
residue 13-14
type binding
ligand IPH: PHENOL
sequence EA
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

197) chain F
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

198) chain K
residue 12
type binding
ligand IPH: PHENOL
sequence S
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

199) chain K
residue 5
type binding
ligand IPH: PHENOL
sequence Q
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

200) chain L
residue 15
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

201) chain L
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

202) chain H
residue 9
type binding
ligand IPH: PHENOL
sequence S
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

203) chain K
residue 8
type binding
ligand IPH: PHENOL
sequence T
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

204) chain F
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

205) chain H
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

206) chain H
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

207) chain K
residue 2
type binding
ligand IPH: PHENOL
sequence I
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

208) chain K
residue 6-7
type binding
ligand IPH: PHENOL
sequence CC
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

209) chain K
residue 9-13
type binding
ligand IPH: PHENOL
sequence SICSL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

210) chain K
residue 16
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

211) chain L
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

212) chain L
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

213) chain L
residue 13-15
type binding
ligand IPH: PHENOL
sequence EAL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

214) chain K
residue 15
type binding
ligand IPH: PHENOL
sequence Q
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

215) chain L
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

216) chain K
residue 5
type binding
ligand IPH: PHENOL
sequence Q
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

217) chain F
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

218) chain K
residue 8
type binding
ligand IPH: PHENOL
sequence T
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32


Display surface

Download
Links