eF-site ID 1aiy_3-L
PDB Code 1aiy
Model 3
Chain L

click to enlarge
Title R6 HUMAN INSULIN HEXAMER (SYMMETRIC), NMR, 10 STRUCTURES
Classification HORMONE
Compound R6 INSULIN HEXAMER
Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens;
Sequence L:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  R6 INSULIN HEXAMER, PHENOL


Functional site

1) chain L
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

2) chain L
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_D_32

3) chain L
residue 6
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

4) chain L
residue 10
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

5) chain L
residue 9
type binding
ligand ZN: ZINC ION
sequence S
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

6) chain L
residue 13
type binding
ligand ZN: ZINC ION
sequence E
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_D_31

7) chain L
residue 16-17
type binding
ligand IPH: PHENOL
sequence YL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

8) chain L
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

9) chain L
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

10) chain L
residue 13-14
type binding
ligand IPH: PHENOL
sequence EA
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

11) chain L
residue 15
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

12) chain L
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

13) chain L
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

14) chain L
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

15) chain L
residue 13-15
type binding
ligand IPH: PHENOL
sequence EAL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

16) chain L
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32


Display surface

Download
Links