eF-site ID 1aiy_10-B
PDB Code 1aiy
Model 10
Chain B

click to enlarge
Title R6 HUMAN INSULIN HEXAMER (SYMMETRIC), NMR, 10 STRUCTURES
Classification HORMONE
Compound R6 INSULIN HEXAMER
Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens;
Sequence B:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  R6 INSULIN HEXAMER, PHENOL


Functional site

1) chain B
residue 6
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ZN B 31
source : AC1

2) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 31
source : AC1

3) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE IPH B 32
source : AC2

4) chain B
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH B 32
source : AC2

5) chain B
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE IPH B 32
source : AC2

6) chain B
residue 2
type
ligand
sequence V
description BINDING SITE FOR RESIDUE IPH J 31
source : AC7

7) chain B
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE IPH J 31
source : AC7

8) chain B
residue 6
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH J 31
source : AC7

9) chain B
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

10) chain B
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

11) chain B
residue 13-15
type binding
ligand IPH: PHENOL
sequence EAL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

12) chain B
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

13) chain B
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

14) chain B
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_31

15) chain B
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

16) chain B
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_33

17) chain B
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

18) chain B
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_J_32

19) chain B
residue 6
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

20) chain B
residue 10
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

21) chain B
residue 9
type binding
ligand ZN: ZINC ION
sequence S
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

22) chain B
residue 16-17
type binding
ligand IPH: PHENOL
sequence YL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_32

23) chain B
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

24) chain B
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_31

25) chain B
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33

26) chain B
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_H_33


Display surface

Download
Links