eF-site ID 1aiy_1-F
PDB Code 1aiy
Model 1
Chain F

click to enlarge
Title R6 HUMAN INSULIN HEXAMER (SYMMETRIC), NMR, 10 STRUCTURES
Classification HORMONE
Compound R6 INSULIN HEXAMER
Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens;
Sequence F:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  R6 INSULIN HEXAMER, PHENOL


Functional site

1) chain F
residue 6
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ZN B 31
source : AC1

2) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 31
source : AC1

3) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE IPH F 32
source : AC5

4) chain F
residue 17
type
ligand
sequence L
description BINDING SITE FOR RESIDUE IPH L 31
source : AC8

5) chain F
residue 2
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

6) chain F
residue 5-6
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_B_32

7) chain F
residue 6
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

8) chain F
residue 10
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

9) chain F
residue 9
type binding
ligand ZN: ZINC ION
sequence S
description ZINC ION binding site
source pdb_hetatom : ZN_1aiy_B_31

10) chain F
residue 7
type binding
ligand IPH: PHENOL
sequence C
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

11) chain F
residue 10-11
type binding
ligand IPH: PHENOL
sequence HL
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

12) chain F
residue 13-14
type binding
ligand IPH: PHENOL
sequence EA
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

13) chain F
residue 18
type binding
ligand IPH: PHENOL
sequence V
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

14) chain F
residue 15
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_F_32

15) chain F
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

16) chain F
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_31

17) chain F
residue 17
type binding
ligand IPH: PHENOL
sequence L
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32

18) chain F
residue 16
type binding
ligand IPH: PHENOL
sequence Y
description PHENOL binding site
source pdb_hetatom : IPH_1aiy_L_32


Display surface

Download
Links