eF-site ID 1ahr-A PDB Code 1ahr Chain A click to enlarge Title CALMODULIN MUTANT WITH A TWO RESIDUE DELETION IN THE CENTRAL HELIX Classification CALCIUM-BINDING PROTEIN Compound CALMODULIN Source null (CALM_CHICK) Sequence A:  ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG QNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDSE EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVD EMIREADIDGDGQVNYEEFVTMMTSK Description Functional site 1) chain A residue 20 type sequence D description BINDING SITE FOR RESIDUE CA A 149 source : AC1 2) chain A residue 22 type sequence D description BINDING SITE FOR RESIDUE CA A 149 source : AC1 3) chain A residue 24 type sequence D description BINDING SITE FOR RESIDUE CA A 149 source : AC1 4) chain A residue 26 type sequence T description BINDING SITE FOR RESIDUE CA A 149 source : AC1 5) chain A residue 31 type sequence E description BINDING SITE FOR RESIDUE CA A 149 source : AC1 6) chain A residue 56 type sequence D description BINDING SITE FOR RESIDUE CA A 150 source : AC2 7) chain A residue 58 type sequence D description BINDING SITE FOR RESIDUE CA A 150 source : AC2 8) chain A residue 60 type sequence N description BINDING SITE FOR RESIDUE CA A 150 source : AC2 9) chain A residue 62 type sequence T description BINDING SITE FOR RESIDUE CA A 150 source : AC2 10) chain A residue 67 type sequence E description BINDING SITE FOR RESIDUE CA A 150 source : AC2 11) chain A residue 93 type sequence D description BINDING SITE FOR RESIDUE CA A 151 source : AC3 12) chain A residue 95 type sequence D description BINDING SITE FOR RESIDUE CA A 151 source : AC3 13) chain A residue 97 type sequence N description BINDING SITE FOR RESIDUE CA A 151 source : AC3 14) chain A residue 99 type sequence F description BINDING SITE FOR RESIDUE CA A 151 source : AC3 15) chain A residue 104 type sequence E description BINDING SITE FOR RESIDUE CA A 151 source : AC3 16) chain A residue 129 type sequence D description BINDING SITE FOR RESIDUE CA A 152 source : AC4 17) chain A residue 131 type sequence D description BINDING SITE FOR RESIDUE CA A 152 source : AC4 18) chain A residue 133 type sequence D description BINDING SITE FOR RESIDUE CA A 152 source : AC4 19) chain A residue 135 type sequence Q description BINDING SITE FOR RESIDUE CA A 152 source : AC4 20) chain A residue 140 type sequence E description BINDING SITE FOR RESIDUE CA A 152 source : AC4 21) chain A residue 20-32 type prosite sequence DKDGDGTITTKEL description EF_HAND_1 EF-hand calcium-binding domain. DKDGDGTITtkEL source prosite : PS00018 22) chain A residue 56-68 type prosite sequence DADGNGTIDFPEF description EF_HAND_1 EF-hand calcium-binding domain. DKDGDGTITtkEL source prosite : PS00018 23) chain A residue 93-105 type prosite sequence DKDGNGFISAAEL description EF_HAND_1 EF-hand calcium-binding domain. DKDGDGTITtkEL source prosite : PS00018 24) chain A residue 129-141 type prosite sequence DIDGDGQVNYEEF description EF_HAND_1 EF-hand calcium-binding domain. DKDGDGTITtkEL source prosite : PS00018 25) chain A residue 21 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 23 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 25 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 27 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 32 type BINDING sequence L description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 68 type BINDING sequence F description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 96 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 98 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 100 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 34) chain A residue 102 type BINDING sequence A description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 35) chain A residue 107 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 36) chain A residue 132 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 37) chain A residue 134 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 38) chain A residue 136 type BINDING sequence V description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 39) chain A residue 138 type BINDING sequence Y description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 40) chain A residue 143 type BINDING sequence T description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 41) chain A residue 57 type BINDING sequence A description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 42) chain A residue 59 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 43) chain A residue 61 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 44) chain A residue 63 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 45) chain A residue 2 type MOD_RES sequence D description N-acetylalanine => ECO:0000250|UniProtKB:P0DP23 source Swiss-Prot : SWS_FT_FI2 46) chain A residue 118 type MOD_RES sequence D description N6,N6,N6-trimethyllysine => ECO:0000250|UniProtKB:P0DP23 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links