eF-site ID 1ahe-B
PDB Code 1ahe
Chain B

click to enlarge
Title ASPARTATE AMINOTRANSFERASE HEXAMUTANT
Classification TRANSFERASE (AMINOTRANSFERASE)
Compound ASPARTATE AMINOTRANSFERASE
Source Escherichia coli (strain K12) (AAT_ECOLI)
Sequence B:  MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDET
GKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQE
LLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSV
KRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFD
ALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQL
SVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV
ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIR
ANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQR
MRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLR
LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Description (1)  ASPARTATE AMINOTRANSFERASE, PYRIDOXAL-5'-PHOSPHATE


Functional site

1) chain B
residue 70
type
ligand
sequence Y
description
source : ACT

2) chain B
residue 292
type
ligand
sequence R
description
source : ACT

3) chain B
residue 296
type
ligand
sequence S
description
source : ACT

4) chain B
residue 297
type
ligand
sequence S
description
source : ACT

5) chain B
residue 15
type
ligand
sequence D
description
source : BCT

6) chain B
residue 17
type
ligand
sequence I
description
source : BCT

7) chain B
residue 18
type
ligand
sequence L
description
source : BCT

8) chain B
residue 37
type
ligand
sequence I
description
source : BCT

9) chain B
residue 38
type
ligand
sequence G
description
source : BCT

10) chain B
residue 39
type
ligand
sequence L
description
source : BCT

11) chain B
residue 107
type
ligand
sequence G
description
source : BCT

12) chain B
residue 108
type
ligand
sequence G
description
source : BCT

13) chain B
residue 109
type
ligand
sequence S
description
source : BCT

14) chain B
residue 140
type
ligand
sequence W
description
source : BCT

15) chain B
residue 194
type
ligand
sequence N
description
source : BCT

16) chain B
residue 222
type
ligand
sequence D
description
source : BCT

17) chain B
residue 224
type
ligand
sequence A
description
source : BCT

18) chain B
residue 225
type
ligand
sequence Y
description
source : BCT

19) chain B
residue 255
type
ligand
sequence S
description
source : BCT

20) chain B
residue 258
type
ligand
sequence K
description
source : BCT

21) chain B
residue 266
type
ligand
sequence R
description
source : BCT

22) chain B
residue 360
type
ligand
sequence F
description
source : BCT

23) chain B
residue 386
type
ligand
sequence R
description
source : BCT

24) chain B
residue 17
type
ligand
sequence I
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

25) chain B
residue 37
type
ligand
sequence I
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

26) chain B
residue 38
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

27) chain B
residue 140
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

28) chain B
residue 194
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

29) chain B
residue 225
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

30) chain B
residue 386
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

31) chain B
residue 70
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

32) chain B
residue 107
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

33) chain B
residue 108
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

34) chain B
residue 109
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

35) chain B
residue 140
type
ligand
sequence W
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

36) chain B
residue 194
type
ligand
sequence N
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

37) chain B
residue 222
type
ligand
sequence D
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

38) chain B
residue 224
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

39) chain B
residue 225
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

40) chain B
residue 255
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

41) chain B
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

42) chain B
residue 258
type
ligand
sequence K
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

43) chain B
residue 266
type
ligand
sequence R
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

44) chain B
residue 183
type BINDING
ligand
sequence G
description Aspartate.
source Swiss-Prot : SWS_FT_FI3

45) chain B
residue 374
type BINDING
ligand
sequence R
description Aspartate.
source Swiss-Prot : SWS_FT_FI3

46) chain B
residue 34
type BINDING
ligand
sequence N
description Aspartate; via amide nitrogen.
source Swiss-Prot : SWS_FT_FI4

47) chain B
residue 255-268
type prosite
ligand
sequence SYSKNFGLYNERVG
description Aminotransferases class-I pyridoxal-phosphate attachment site. [GS]-[LIVMFYTAC]-[GSTA]-K-x(2)-[GSALVN]-[LIVMFA]-x-[GNAR]-{V}-R-[LIVMA]
source prosite : PS00105

48) chain B
residue 106-110
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence PGGSG
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

49) chain B
residue 112
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence L
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

50) chain B
residue 140
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence W
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

51) chain B
residue 143
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence H
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

52) chain B
residue 189
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence H
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

53) chain B
residue 194
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence N
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

54) chain B
residue 222
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence D
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

55) chain B
residue 224-225
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence AY
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

56) chain B
residue 255-258
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence SYSK
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

57) chain B
residue 263
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence Y
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

58) chain B
residue 266-267
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence RV
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

59) chain B
residue 70
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence Y
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

60) chain B
residue 295
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence Y
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

61) chain B
residue 140
type catalytic
ligand
sequence W
description Annotated By Reference To The Literature 1ay4
source CSA : CSA2

62) chain B
residue 222
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ay4
source CSA : CSA2

63) chain B
residue 140
type catalytic
ligand
sequence W
description Annotated By Reference To The Literature 1ay4
source CSA : CSA4

64) chain B
residue 222
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ay4
source CSA : CSA4

65) chain B
residue 258
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ay4
source CSA : CSA4


Display surface

Download
Links