eF-site ID 1ahe-B PDB Code 1ahe Chain B click to enlarge Title ASPARTATE AMINOTRANSFERASE HEXAMUTANT Classification TRANSFERASE (AMINOTRANSFERASE) Compound ASPARTATE AMINOTRANSFERASE Source Escherichia coli (strain K12) (AAT_ECOLI) Sequence B:  MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDET GKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQE LLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSV KRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFD ALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQL SVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIR ANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQR MRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLR LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL Description (1)  ASPARTATE AMINOTRANSFERASE, PYRIDOXAL-5'-PHOSPHATE Functional site 1) chain B residue 70 type ligand sequence Y description source : ACT 2) chain B residue 292 type ligand sequence R description source : ACT 3) chain B residue 296 type ligand sequence S description source : ACT 4) chain B residue 297 type ligand sequence S description source : ACT 5) chain B residue 15 type ligand sequence D description source : BCT 6) chain B residue 17 type ligand sequence I description source : BCT 7) chain B residue 18 type ligand sequence L description source : BCT 8) chain B residue 37 type ligand sequence I description source : BCT 9) chain B residue 38 type ligand sequence G description source : BCT 10) chain B residue 39 type ligand sequence L description source : BCT 11) chain B residue 107 type ligand sequence G description source : BCT 12) chain B residue 108 type ligand sequence G description source : BCT 13) chain B residue 109 type ligand sequence S description source : BCT 14) chain B residue 140 type ligand sequence W description source : BCT 15) chain B residue 194 type ligand sequence N description source : BCT 16) chain B residue 222 type ligand sequence D description source : BCT 17) chain B residue 224 type ligand sequence A description source : BCT 18) chain B residue 225 type ligand sequence Y description source : BCT 19) chain B residue 255 type ligand sequence S description source : BCT 20) chain B residue 258 type ligand sequence K description source : BCT 21) chain B residue 266 type ligand sequence R description source : BCT 22) chain B residue 360 type ligand sequence F description source : BCT 23) chain B residue 386 type ligand sequence R description source : BCT 24) chain B residue 17 type ligand sequence I description BINDING SITE FOR RESIDUE SO4 B 411 source : AC2 25) chain B residue 37 type ligand sequence I description BINDING SITE FOR RESIDUE SO4 B 411 source : AC2 26) chain B residue 38 type ligand sequence G description BINDING SITE FOR RESIDUE SO4 B 411 source : AC2 27) chain B residue 140 type ligand sequence W description BINDING SITE FOR RESIDUE SO4 B 411 source : AC2 28) chain B residue 194 type ligand sequence N description BINDING SITE FOR RESIDUE SO4 B 411 source : AC2 29) chain B residue 225 type ligand sequence Y description BINDING SITE FOR RESIDUE SO4 B 411 source : AC2 30) chain B residue 386 type ligand sequence R description BINDING SITE FOR RESIDUE SO4 B 411 source : AC2 31) chain B residue 70 type ligand sequence Y description BINDING SITE FOR RESIDUE PLP A 412 source : AC3 32) chain B residue 107 type ligand sequence G description BINDING SITE FOR RESIDUE PLP B 412 source : AC4 33) chain B residue 108 type ligand sequence G description BINDING SITE FOR RESIDUE PLP B 412 source : AC4 34) chain B residue 109 type ligand sequence S description BINDING SITE FOR RESIDUE PLP B 412 source : AC4 35) chain B residue 140 type ligand sequence W description BINDING SITE FOR RESIDUE PLP B 412 source : AC4 36) chain B residue 194 type ligand sequence N description BINDING SITE FOR RESIDUE PLP B 412 source : AC4 37) chain B residue 222 type ligand sequence D description BINDING SITE FOR RESIDUE PLP B 412 source : AC4 38) chain B residue 224 type ligand sequence A description BINDING SITE FOR RESIDUE PLP B 412 source : AC4 39) chain B residue 225 type ligand sequence Y description BINDING SITE FOR RESIDUE PLP B 412 source : AC4 40) chain B residue 255 type ligand sequence S description BINDING SITE FOR RESIDUE PLP B 412 source : AC4 41) chain B residue 257 type ligand sequence S description BINDING SITE FOR RESIDUE PLP B 412 source : AC4 42) chain B residue 258 type ligand sequence K description BINDING SITE FOR RESIDUE PLP B 412 source : AC4 43) chain B residue 266 type ligand sequence R description BINDING SITE FOR RESIDUE PLP B 412 source : AC4 44) chain B residue 183 type BINDING ligand sequence G description Aspartate. source Swiss-Prot : SWS_FT_FI3 45) chain B residue 374 type BINDING ligand sequence R description Aspartate. source Swiss-Prot : SWS_FT_FI3 46) chain B residue 34 type BINDING ligand sequence N description Aspartate; via amide nitrogen. source Swiss-Prot : SWS_FT_FI4 47) chain B residue 255-268 type prosite ligand sequence SYSKNFGLYNERVG description Aminotransferases class-I pyridoxal-phosphate attachment site. [GS]-[LIVMFYTAC]-[GSTA]-K-x(2)-[GSALVN]-[LIVMFA]-x-[GNAR]-{V}-R-[LIVMA] source prosite : PS00105 48) chain B residue 106-110 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence PGGSG description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_B_412 49) chain B residue 112 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence L description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_B_412 50) chain B residue 140 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence W description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_B_412 51) chain B residue 143 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence H description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_B_412 52) chain B residue 189 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence H description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_B_412 53) chain B residue 194 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence N description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_B_412 54) chain B residue 222 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence D description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_B_412 55) chain B residue 224-225 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence AY description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_B_412 56) chain B residue 255-258 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence SYSK description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_B_412 57) chain B residue 263 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence Y description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_B_412 58) chain B residue 266-267 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence RV description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_B_412 59) chain B residue 70 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence Y description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_A_412 60) chain B residue 295 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence Y description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_A_412 61) chain B residue 140 type catalytic ligand sequence W description Annotated By Reference To The Literature 1ay4 source CSA : CSA2 62) chain B residue 222 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ay4 source CSA : CSA2 63) chain B residue 140 type catalytic ligand sequence W description Annotated By Reference To The Literature 1ay4 source CSA : CSA4 64) chain B residue 222 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ay4 source CSA : CSA4 65) chain B residue 258 type catalytic ligand sequence K description Annotated By Reference To The Literature 1ay4 source CSA : CSA4

Display surface Download Links