eF-site ID 1ahe-AB
PDB Code 1ahe
Chain A, B

click to enlarge
Title ASPARTATE AMINOTRANSFERASE HEXAMUTANT
Classification TRANSFERASE (AMINOTRANSFERASE)
Compound ASPARTATE AMINOTRANSFERASE
Source Escherichia coli (strain K12) (AAT_ECOLI)
Sequence A:  MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDET
GKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQE
LLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSV
KRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFD
ALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQL
SVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV
ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIR
ANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQR
MRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLR
LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
B:  MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDET
GKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQE
LLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSV
KRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFD
ALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQL
SVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV
ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIR
ANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQR
MRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLR
LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Description (1)  ASPARTATE AMINOTRANSFERASE, PYRIDOXAL-5'-PHOSPHATE


Functional site

1) chain A
residue 15
type
ligand
sequence D
description
source : ACT

2) chain A
residue 17
type
ligand
sequence I
description
source : ACT

3) chain A
residue 18
type
ligand
sequence L
description
source : ACT

4) chain A
residue 37
type
ligand
sequence I
description
source : ACT

5) chain A
residue 38
type
ligand
sequence G
description
source : ACT

6) chain A
residue 39
type
ligand
sequence L
description
source : ACT

7) chain B
residue 70
type
ligand
sequence Y
description
source : ACT

8) chain A
residue 107
type
ligand
sequence G
description
source : ACT

9) chain A
residue 108
type
ligand
sequence G
description
source : ACT

10) chain A
residue 109
type
ligand
sequence S
description
source : ACT

11) chain A
residue 140
type
ligand
sequence W
description
source : ACT

12) chain A
residue 194
type
ligand
sequence N
description
source : ACT

13) chain A
residue 222
type
ligand
sequence D
description
source : ACT

14) chain A
residue 224
type
ligand
sequence A
description
source : ACT

15) chain A
residue 225
type
ligand
sequence Y
description
source : ACT

16) chain A
residue 255
type
ligand
sequence S
description
source : ACT

17) chain A
residue 258
type
ligand
sequence K
description
source : ACT

18) chain A
residue 266
type
ligand
sequence R
description
source : ACT

19) chain B
residue 292
type
ligand
sequence R
description
source : ACT

20) chain B
residue 296
type
ligand
sequence S
description
source : ACT

21) chain B
residue 297
type
ligand
sequence S
description
source : ACT

22) chain A
residue 360
type
ligand
sequence F
description
source : ACT

23) chain A
residue 386
type
ligand
sequence R
description
source : ACT

24) chain B
residue 15
type
ligand
sequence D
description
source : BCT

25) chain B
residue 17
type
ligand
sequence I
description
source : BCT

26) chain B
residue 18
type
ligand
sequence L
description
source : BCT

27) chain B
residue 37
type
ligand
sequence I
description
source : BCT

28) chain B
residue 38
type
ligand
sequence G
description
source : BCT

29) chain B
residue 39
type
ligand
sequence L
description
source : BCT

30) chain A
residue 70
type
ligand
sequence Y
description
source : BCT

31) chain B
residue 107
type
ligand
sequence G
description
source : BCT

32) chain B
residue 108
type
ligand
sequence G
description
source : BCT

33) chain B
residue 109
type
ligand
sequence S
description
source : BCT

34) chain B
residue 140
type
ligand
sequence W
description
source : BCT

35) chain B
residue 194
type
ligand
sequence N
description
source : BCT

36) chain B
residue 222
type
ligand
sequence D
description
source : BCT

37) chain B
residue 224
type
ligand
sequence A
description
source : BCT

38) chain B
residue 225
type
ligand
sequence Y
description
source : BCT

39) chain B
residue 255
type
ligand
sequence S
description
source : BCT

40) chain B
residue 258
type
ligand
sequence K
description
source : BCT

41) chain B
residue 266
type
ligand
sequence R
description
source : BCT

42) chain A
residue 292
type
ligand
sequence R
description
source : BCT

43) chain A
residue 296
type
ligand
sequence S
description
source : BCT

44) chain A
residue 297
type
ligand
sequence S
description
source : BCT

45) chain B
residue 360
type
ligand
sequence F
description
source : BCT

46) chain B
residue 386
type
ligand
sequence R
description
source : BCT

47) chain A
residue 17
type
ligand
sequence I
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

48) chain A
residue 37
type
ligand
sequence I
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

49) chain A
residue 38
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

50) chain A
residue 140
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

51) chain A
residue 194
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

52) chain A
residue 225
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

53) chain A
residue 360
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

54) chain A
residue 386
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

55) chain B
residue 17
type
ligand
sequence I
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

56) chain B
residue 37
type
ligand
sequence I
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

57) chain B
residue 38
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

58) chain B
residue 140
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

59) chain B
residue 194
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

60) chain B
residue 225
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

61) chain B
residue 386
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 411
source : AC2

62) chain A
residue 107
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

63) chain A
residue 108
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

64) chain A
residue 109
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

65) chain A
residue 140
type
ligand
sequence W
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

66) chain A
residue 194
type
ligand
sequence N
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

67) chain A
residue 222
type
ligand
sequence D
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

68) chain A
residue 225
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

69) chain A
residue 255
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

70) chain A
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

71) chain A
residue 258
type
ligand
sequence K
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

72) chain A
residue 266
type
ligand
sequence R
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

73) chain B
residue 70
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

74) chain A
residue 70
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

75) chain B
residue 107
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

76) chain B
residue 108
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

77) chain B
residue 109
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

78) chain B
residue 140
type
ligand
sequence W
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

79) chain B
residue 194
type
ligand
sequence N
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

80) chain B
residue 222
type
ligand
sequence D
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

81) chain B
residue 224
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

82) chain B
residue 225
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

83) chain B
residue 255
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

84) chain B
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

85) chain B
residue 258
type
ligand
sequence K
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

86) chain B
residue 266
type
ligand
sequence R
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

87) chain A
residue 183
type BINDING
ligand
sequence G
description Aspartate.
source Swiss-Prot : SWS_FT_FI1

88) chain A
residue 374
type BINDING
ligand
sequence R
description Aspartate.
source Swiss-Prot : SWS_FT_FI1

89) chain A
residue 34
type BINDING
ligand
sequence N
description Aspartate; via amide nitrogen.
source Swiss-Prot : SWS_FT_FI2

90) chain B
residue 183
type BINDING
ligand
sequence G
description Aspartate.
source Swiss-Prot : SWS_FT_FI3

91) chain B
residue 374
type BINDING
ligand
sequence R
description Aspartate.
source Swiss-Prot : SWS_FT_FI3

92) chain B
residue 34
type BINDING
ligand
sequence N
description Aspartate; via amide nitrogen.
source Swiss-Prot : SWS_FT_FI4

93) chain A
residue 255-268
type prosite
ligand
sequence SYSKNFGLYNERVG
description Aminotransferases class-I pyridoxal-phosphate attachment site. [GS]-[LIVMFYTAC]-[GSTA]-K-x(2)-[GSALVN]-[LIVMFA]-x-[GNAR]-{V}-R-[LIVMA]
source prosite : PS00105

94) chain B
residue 255-268
type prosite
ligand
sequence SYSKNFGLYNERVG
description Aminotransferases class-I pyridoxal-phosphate attachment site. [GS]-[LIVMFYTAC]-[GSTA]-K-x(2)-[GSALVN]-[LIVMFA]-x-[GNAR]-{V}-R-[LIVMA]
source prosite : PS00105

95) chain A
residue 70
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence Y
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

96) chain A
residue 296
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence S
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

97) chain B
residue 106-110
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence PGGSG
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

98) chain B
residue 112
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence L
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

99) chain B
residue 140
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence W
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

100) chain B
residue 143
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence H
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

101) chain B
residue 189
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence H
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

102) chain B
residue 194
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence N
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

103) chain B
residue 222
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence D
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

104) chain B
residue 224-225
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence AY
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

105) chain B
residue 255-258
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence SYSK
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

106) chain B
residue 263
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence Y
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

107) chain B
residue 266-267
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence RV
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

108) chain A
residue 106-110
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence PGGSG
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

109) chain A
residue 112
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence L
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

110) chain A
residue 140
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence W
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

111) chain A
residue 143
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence H
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

112) chain A
residue 189
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence H
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

113) chain A
residue 194
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence N
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

114) chain A
residue 222
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence D
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

115) chain A
residue 224-225
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence AY
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

116) chain A
residue 255-258
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence SYSK
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

117) chain A
residue 266-267
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence RV
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

118) chain B
residue 70
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence Y
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

119) chain B
residue 295
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence Y
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

120) chain A
residue 140
type catalytic
ligand
sequence W
description Annotated By Reference To The Literature 1ay4
source CSA : CSA1

121) chain A
residue 222
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ay4
source CSA : CSA1

122) chain B
residue 140
type catalytic
ligand
sequence W
description Annotated By Reference To The Literature 1ay4
source CSA : CSA2

123) chain B
residue 222
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ay4
source CSA : CSA2

124) chain A
residue 140
type catalytic
ligand
sequence W
description Annotated By Reference To The Literature 1ay4
source CSA : CSA3

125) chain A
residue 222
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ay4
source CSA : CSA3

126) chain A
residue 258
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ay4
source CSA : CSA3

127) chain B
residue 140
type catalytic
ligand
sequence W
description Annotated By Reference To The Literature 1ay4
source CSA : CSA4

128) chain B
residue 222
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ay4
source CSA : CSA4

129) chain B
residue 258
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ay4
source CSA : CSA4


Display surface

Download
Links