eF-site ID 1ahe-A PDB Code 1ahe Chain A click to enlarge Title ASPARTATE AMINOTRANSFERASE HEXAMUTANT Classification TRANSFERASE (AMINOTRANSFERASE) Compound ASPARTATE AMINOTRANSFERASE Source Escherichia coli (strain K12) (AAT_ECOLI) Sequence A:  MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDET GKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQE LLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSV KRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFD ALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQL SVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIR ANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQR MRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLR LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL Description (1)  ASPARTATE AMINOTRANSFERASE, PYRIDOXAL-5'-PHOSPHATE Functional site 1) chain A residue 15 type ligand sequence D description source : ACT 2) chain A residue 17 type ligand sequence I description source : ACT 3) chain A residue 18 type ligand sequence L description source : ACT 4) chain A residue 37 type ligand sequence I description source : ACT 5) chain A residue 38 type ligand sequence G description source : ACT 6) chain A residue 39 type ligand sequence L description source : ACT 7) chain A residue 107 type ligand sequence G description source : ACT 8) chain A residue 108 type ligand sequence G description source : ACT 9) chain A residue 109 type ligand sequence S description source : ACT 10) chain A residue 140 type ligand sequence W description source : ACT 11) chain A residue 194 type ligand sequence N description source : ACT 12) chain A residue 222 type ligand sequence D description source : ACT 13) chain A residue 224 type ligand sequence A description source : ACT 14) chain A residue 225 type ligand sequence Y description source : ACT 15) chain A residue 255 type ligand sequence S description source : ACT 16) chain A residue 258 type ligand sequence K description source : ACT 17) chain A residue 266 type ligand sequence R description source : ACT 18) chain A residue 360 type ligand sequence F description source : ACT 19) chain A residue 386 type ligand sequence R description source : ACT 20) chain A residue 70 type ligand sequence Y description source : BCT 21) chain A residue 292 type ligand sequence R description source : BCT 22) chain A residue 296 type ligand sequence S description source : BCT 23) chain A residue 297 type ligand sequence S description source : BCT 24) chain A residue 17 type ligand sequence I description BINDING SITE FOR RESIDUE SO4 A 411 source : AC1 25) chain A residue 37 type ligand sequence I description BINDING SITE FOR RESIDUE SO4 A 411 source : AC1 26) chain A residue 38 type ligand sequence G description BINDING SITE FOR RESIDUE SO4 A 411 source : AC1 27) chain A residue 140 type ligand sequence W description BINDING SITE FOR RESIDUE SO4 A 411 source : AC1 28) chain A residue 194 type ligand sequence N description BINDING SITE FOR RESIDUE SO4 A 411 source : AC1 29) chain A residue 225 type ligand sequence Y description BINDING SITE FOR RESIDUE SO4 A 411 source : AC1 30) chain A residue 360 type ligand sequence F description BINDING SITE FOR RESIDUE SO4 A 411 source : AC1 31) chain A residue 386 type ligand sequence R description BINDING SITE FOR RESIDUE SO4 A 411 source : AC1 32) chain A residue 107 type ligand sequence G description BINDING SITE FOR RESIDUE PLP A 412 source : AC3 33) chain A residue 108 type ligand sequence G description BINDING SITE FOR RESIDUE PLP A 412 source : AC3 34) chain A residue 109 type ligand sequence S description BINDING SITE FOR RESIDUE PLP A 412 source : AC3 35) chain A residue 140 type ligand sequence W description BINDING SITE FOR RESIDUE PLP A 412 source : AC3 36) chain A residue 194 type ligand sequence N description BINDING SITE FOR RESIDUE PLP A 412 source : AC3 37) chain A residue 222 type ligand sequence D description BINDING SITE FOR RESIDUE PLP A 412 source : AC3 38) chain A residue 225 type ligand sequence Y description BINDING SITE FOR RESIDUE PLP A 412 source : AC3 39) chain A residue 255 type ligand sequence S description BINDING SITE FOR RESIDUE PLP A 412 source : AC3 40) chain A residue 257 type ligand sequence S description BINDING SITE FOR RESIDUE PLP A 412 source : AC3 41) chain A residue 258 type ligand sequence K description BINDING SITE FOR RESIDUE PLP A 412 source : AC3 42) chain A residue 266 type ligand sequence R description BINDING SITE FOR RESIDUE PLP A 412 source : AC3 43) chain A residue 70 type ligand sequence Y description BINDING SITE FOR RESIDUE PLP B 412 source : AC4 44) chain A residue 183 type BINDING ligand sequence G description Aspartate. source Swiss-Prot : SWS_FT_FI1 45) chain A residue 374 type BINDING ligand sequence R description Aspartate. source Swiss-Prot : SWS_FT_FI1 46) chain A residue 34 type BINDING ligand sequence N description Aspartate; via amide nitrogen. source Swiss-Prot : SWS_FT_FI2 47) chain A residue 255-268 type prosite ligand sequence SYSKNFGLYNERVG description Aminotransferases class-I pyridoxal-phosphate attachment site. [GS]-[LIVMFYTAC]-[GSTA]-K-x(2)-[GSALVN]-[LIVMFA]-x-[GNAR]-{V}-R-[LIVMA] source prosite : PS00105 48) chain A residue 70 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence Y description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_B_412 49) chain A residue 296 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence S description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_B_412 50) chain A residue 106-110 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence PGGSG description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_A_412 51) chain A residue 112 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence L description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_A_412 52) chain A residue 140 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence W description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_A_412 53) chain A residue 143 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence H description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_A_412 54) chain A residue 189 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence H description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_A_412 55) chain A residue 194 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence N description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_A_412 56) chain A residue 222 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence D description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_A_412 57) chain A residue 224-225 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence AY description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_A_412 58) chain A residue 255-258 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence SYSK description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_A_412 59) chain A residue 266-267 type binding ligand PLP: PYRIDOXAL-5'-PHOSPHATE sequence RV description PYRIDOXAL-5'-PHOSPHATE binding site source pdb_hetatom : PLP_1ahe_A_412 60) chain A residue 140 type catalytic ligand sequence W description Annotated By Reference To The Literature 1ay4 source CSA : CSA1 61) chain A residue 222 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ay4 source CSA : CSA1 62) chain A residue 140 type catalytic ligand sequence W description Annotated By Reference To The Literature 1ay4 source CSA : CSA3 63) chain A residue 222 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ay4 source CSA : CSA3 64) chain A residue 258 type catalytic ligand sequence K description Annotated By Reference To The Literature 1ay4 source CSA : CSA3

Display surface Download Links