eF-site ID 1ahe-A
PDB Code 1ahe
Chain A

click to enlarge
Title ASPARTATE AMINOTRANSFERASE HEXAMUTANT
Classification TRANSFERASE (AMINOTRANSFERASE)
Compound ASPARTATE AMINOTRANSFERASE
Source Escherichia coli (strain K12) (AAT_ECOLI)
Sequence A:  MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDET
GKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQE
LLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSV
KRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFD
ALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQL
SVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV
ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIR
ANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQR
MRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLR
LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Description (1)  ASPARTATE AMINOTRANSFERASE, PYRIDOXAL-5'-PHOSPHATE


Functional site

1) chain A
residue 15
type
ligand
sequence D
description
source : ACT

2) chain A
residue 17
type
ligand
sequence I
description
source : ACT

3) chain A
residue 18
type
ligand
sequence L
description
source : ACT

4) chain A
residue 37
type
ligand
sequence I
description
source : ACT

5) chain A
residue 38
type
ligand
sequence G
description
source : ACT

6) chain A
residue 39
type
ligand
sequence L
description
source : ACT

7) chain A
residue 107
type
ligand
sequence G
description
source : ACT

8) chain A
residue 108
type
ligand
sequence G
description
source : ACT

9) chain A
residue 109
type
ligand
sequence S
description
source : ACT

10) chain A
residue 140
type
ligand
sequence W
description
source : ACT

11) chain A
residue 194
type
ligand
sequence N
description
source : ACT

12) chain A
residue 222
type
ligand
sequence D
description
source : ACT

13) chain A
residue 224
type
ligand
sequence A
description
source : ACT

14) chain A
residue 225
type
ligand
sequence Y
description
source : ACT

15) chain A
residue 255
type
ligand
sequence S
description
source : ACT

16) chain A
residue 258
type
ligand
sequence K
description
source : ACT

17) chain A
residue 266
type
ligand
sequence R
description
source : ACT

18) chain A
residue 360
type
ligand
sequence F
description
source : ACT

19) chain A
residue 386
type
ligand
sequence R
description
source : ACT

20) chain A
residue 70
type
ligand
sequence Y
description
source : BCT

21) chain A
residue 292
type
ligand
sequence R
description
source : BCT

22) chain A
residue 296
type
ligand
sequence S
description
source : BCT

23) chain A
residue 297
type
ligand
sequence S
description
source : BCT

24) chain A
residue 17
type
ligand
sequence I
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

25) chain A
residue 37
type
ligand
sequence I
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

26) chain A
residue 38
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

27) chain A
residue 140
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

28) chain A
residue 194
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

29) chain A
residue 225
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

30) chain A
residue 360
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

31) chain A
residue 386
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 411
source : AC1

32) chain A
residue 107
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

33) chain A
residue 108
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

34) chain A
residue 109
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

35) chain A
residue 140
type
ligand
sequence W
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

36) chain A
residue 194
type
ligand
sequence N
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

37) chain A
residue 222
type
ligand
sequence D
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

38) chain A
residue 225
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

39) chain A
residue 255
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

40) chain A
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

41) chain A
residue 258
type
ligand
sequence K
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

42) chain A
residue 266
type
ligand
sequence R
description BINDING SITE FOR RESIDUE PLP A 412
source : AC3

43) chain A
residue 70
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PLP B 412
source : AC4

44) chain A
residue 183
type BINDING
ligand
sequence G
description Aspartate.
source Swiss-Prot : SWS_FT_FI1

45) chain A
residue 374
type BINDING
ligand
sequence R
description Aspartate.
source Swiss-Prot : SWS_FT_FI1

46) chain A
residue 34
type BINDING
ligand
sequence N
description Aspartate; via amide nitrogen.
source Swiss-Prot : SWS_FT_FI2

47) chain A
residue 255-268
type prosite
ligand
sequence SYSKNFGLYNERVG
description Aminotransferases class-I pyridoxal-phosphate attachment site. [GS]-[LIVMFYTAC]-[GSTA]-K-x(2)-[GSALVN]-[LIVMFA]-x-[GNAR]-{V}-R-[LIVMA]
source prosite : PS00105

48) chain A
residue 70
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence Y
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

49) chain A
residue 296
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence S
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_B_412

50) chain A
residue 106-110
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence PGGSG
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

51) chain A
residue 112
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence L
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

52) chain A
residue 140
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence W
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

53) chain A
residue 143
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence H
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

54) chain A
residue 189
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence H
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

55) chain A
residue 194
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence N
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

56) chain A
residue 222
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence D
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

57) chain A
residue 224-225
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence AY
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

58) chain A
residue 255-258
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence SYSK
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

59) chain A
residue 266-267
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence RV
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_1ahe_A_412

60) chain A
residue 140
type catalytic
ligand
sequence W
description Annotated By Reference To The Literature 1ay4
source CSA : CSA1

61) chain A
residue 222
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ay4
source CSA : CSA1

62) chain A
residue 140
type catalytic
ligand
sequence W
description Annotated By Reference To The Literature 1ay4
source CSA : CSA3

63) chain A
residue 222
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ay4
source CSA : CSA3

64) chain A
residue 258
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ay4
source CSA : CSA3


Display surface

Download
Links