eF-site ID 1a9m-A PDB Code 1a9m Chain A click to enlarge Title G48H MUTANT OF HIV-1 PROTEASE IN COMPLEX WITH A PEPTIDIC INHIBITOR U-89360E Classification ASPARTYL PROTEASE Compound HIV-1 PROTEASE Source (POL_HV1PV) Sequence A:  PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPG RWKPKMIHGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT PVNIIGRNLLTQIGCTLNF Description Functional site 1) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE U0E B 100 source : AC1 2) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE U0E B 100 source : AC1 3) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE U0E B 100 source : AC1 4) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE U0E B 100 source : AC1 5) chain A residue 82 type sequence V description BINDING SITE FOR RESIDUE U0E B 100 source : AC1 6) chain A residue 84 type sequence I description BINDING SITE FOR RESIDUE U0E B 100 source : AC1 7) chain A residue 22-33 type prosite sequence ALLDTGADDTVL description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADDTVL source prosite : PS00141 8) chain A residue 25 type ACT_SITE sequence D description For protease activity; shared with dimeric partner => ECO:0000255|PROSITE-ProRule:PRU10094, ECO:0000269|PubMed:12924029 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 64 type SITE sequence I description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 99 type SITE sequence F description Cleavage; by viral protease => ECO:0000269|PubMed:2476069 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 64 type MOD_RES sequence I description Phosphotyrosine; by host => ECO:0000250 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links