eF-site ID 1a79-A PDB Code 1a79 Chain A click to enlarge Title CRYSTAL STRUCTURE OF THE TRNA SPLICING ENDONUCLEASE FROM METHANOCOCCUS JANNASCHII Classification ENDONUCLEASE Compound TRNA ENDONUCLEASE Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (ENDA_METJA) Sequence A:  KITGLLDGDRVIVFDKNGISKLSARHYGNVEGNFLSLSLV EALYLINLGWLEVKYKDNKPLSFEELYEYARNVEERLCLK YLVYKDLRTRGYIVKTGLKYGADFRLYERGANIDKEHSVY LVKVFPEDSSFLLSELTGFVRVAHSVRKKLLIAIVDADGD IVYYNMTYVKP Description Functional site 1) chain A residue 108 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 1 source : AC1 2) chain A residue 113 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1 source : AC1 3) chain A residue 115 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 1 source : AC1 4) chain A residue 125 type sequence H description BINDING SITE FOR RESIDUE SO4 A 1 source : AC1 5) chain A residue 126 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1 source : AC1 6) chain A residue 156 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1 source : AC1 7) chain A residue 75 type sequence Y description BINDING SITE FOR RESIDUE AU A 4 source : AC6 8) chain A residue 86 type sequence C description BINDING SITE FOR RESIDUE AU A 4 source : AC6 9) chain A residue 115 type catalytic sequence Y description 565 source MCSA : MCSA1 10) chain A residue 125 type catalytic sequence H description 565 source MCSA : MCSA1 11) chain A residue 156 type catalytic sequence K description 565 source MCSA : MCSA1 12) chain A residue 115 type ACT_SITE sequence Y description source Swiss-Prot : SWS_FT_FI1 13) chain A residue 125 type ACT_SITE sequence H description source Swiss-Prot : SWS_FT_FI1 14) chain A residue 156 type ACT_SITE sequence K description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links