eF-site ID 1a4j-A
PDB Code 1a4j
Chain A

click to enlarge
Title DIELS ALDER CATALYTIC ANTIBODY GERMLINE PRECURSOR
Classification IMMUNOGLOBULIN
Compound IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY (LIGHT CHAIN)
Source Homo sapiens (Human) (1A4J)
Sequence A:  ELVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHW
YLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKI
SRVEAEDLGVYFCSQSTHVPPTFGGGTKLEIKRTVAAPSV
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRG
Description (1)  IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY

Display surface

Download
Links