eF-site ID 1a4i-A
PDB Code 1a4i
Chain A

click to enlarge
Title HUMAN TETRAHYDROFOLATE DEHYDROGENASE / CYCLOHYDROLASE
Classification OXIDOREDUCTASE
Compound METHYLENETETRAHYDROFOLATE DEHYDROGENASE / METHENYLTETRAHYDROFOLATE CYCLOHYDROLASE
Source Homo sapiens (Human) (C1TC_HUMAN)
Sequence A:  APAEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAIL
QVGNRDDSNLYINVKLKAAEEIGIKATHIKLPRTTTESEV
MKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPE
KDVDGLTSINAGRLARGDLNDCFIPCTPKGCLELIKETGV
PIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAH
LDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYK
VVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESA
KRFLE
Description (1)  METHYLENETETRAHYDROFOLATE DEHYDROGENASE / METHENYLTETRAHYDROFOLATE CYCLOHYDROLASE, NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE


Functional site

1) chain A
residue 148
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

2) chain A
residue 172
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

3) chain A
residue 173
type
ligand
sequence R
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

4) chain A
residue 174
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

5) chain A
residue 177
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

6) chain A
residue 196
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

7) chain A
residue 197
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

8) chain A
residue 215
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

9) chain A
residue 216
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

10) chain A
residue 217
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

11) chain A
residue 218
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

12) chain A
residue 236
type
ligand
sequence C
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

13) chain A
residue 237
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

14) chain A
residue 238
type
ligand
sequence I
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

15) chain A
residue 276
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NDP A 302
source : AC1

16) chain A
residue 197
type BINDING
ligand
sequence S
description NADP. {ECO:0000269|PubMed:10828945}.
source Swiss-Prot : SWS_FT_FI1

17) chain A
residue 172-174
type NP_BIND
ligand
sequence GRS
description NADP. {ECO:0000269|PubMed:10828945}.
source Swiss-Prot : SWS_FT_FI2

18) chain A
residue 56
type catalytic
ligand
sequence K
description a catalytic site defined by CATRES, Medline 20290816, 20461727, 98179934
source CATRES : CATRES1

19) chain A
residue 78-103
type prosite
ligand
sequence ESEVMKYITSLNEDSTVHGFLVQLPL
description Tetrahydrofolate dehydrogenase/cyclohydrolase signature 1. [EQLT]-x-[EQKDS]-[LIVM](2)-x(2)-[LIVM]-x(2)-[LIVMY]-N-x-[DNS]-x(5)
source prosite : PS00766

20) chain A
residue 272-280
type prosite
ligand
sequence PGGVGPMTV
description Tetrahydrofolate dehydrogenase/cyclohydrolase signature 2. P-[GK]-G-[VI]-G-P-[MFI]-T-[IVA]
source prosite : PS00767

21) chain A
residue 148
type binding
ligand NDP: NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence T
description NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NDP_1a4i_A_302

22) chain A
residue 171-174
type binding
ligand NDP: NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence VGRS
description NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NDP_1a4i_A_302

23) chain A
residue 176-178
type binding
ligand NDP: NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence IVG
description NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NDP_1a4i_A_302

24) chain A
residue 195-198
type binding
ligand NDP: NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence CHSK
description NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NDP_1a4i_A_302

25) chain A
residue 202
type binding
ligand NDP: NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence L
description NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NDP_1a4i_A_302

26) chain A
residue 215-218
type binding
ligand NDP: NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence ATGQ
description NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NDP_1a4i_A_302

27) chain A
residue 221
type binding
ligand NDP: NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence M
description NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NDP_1a4i_A_302

28) chain A
residue 236-239
type binding
ligand NDP: NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence CGIN
description NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NDP_1a4i_A_302

29) chain A
residue 255
type binding
ligand NDP: NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence D
description NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NDP_1a4i_A_302

30) chain A
residue 275-276
type binding
ligand NDP: NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence VG
description NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NDP_1a4i_A_302

31) chain A
residue 279
type binding
ligand NDP: NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence T
description NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NDP_1a4i_A_302

32) chain A
residue 56
type catalytic
ligand
sequence K
description a catalytic site defined by CSA, PubMed 10828945, 9519408, 11904299
source CSA : CSA1

33) chain A
residue 100
type catalytic
ligand
sequence Q
description a catalytic site defined by CSA, PubMed 10828945, 9519408, 11904299
source CSA : CSA1


Display surface

Download
Links