eF-site ID 1a4b-A PDB Code 1a4b Chain A click to enlarge Title AZURIN MUTANT WITH MET 121 REPLACED BY HIS, PH 6.5 CRYSTAL FORM, DATA COLLECTED AT-180 DEGREES CELSIUS Classification ELECTRON TRANSPORT Compound AZURIN Source null (AZUR_ALCDE) Sequence A:  AQCEATIESNDAMQYDLKEMVVDKSCKQFTVHLKHVGKMA KSAMGHNWVLTKEADKEGVATDGMNAGLAQDYVKAGDTRV IAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAM HKGTLKLSN Description Functional site 1) chain A residue 46 type sequence H description BINDING SITE FOR RESIDUE CU A 130 source : AC1 2) chain A residue 112 type sequence C description BINDING SITE FOR RESIDUE CU A 130 source : AC1 3) chain A residue 117 type sequence H description BINDING SITE FOR RESIDUE CU A 130 source : AC1 4) chain A residue 121 type sequence H description BINDING SITE FOR RESIDUE CU A 130 source : AC1 5) chain A residue 75 type sequence A description BINDING SITE FOR RESIDUE SO4 A 131 source : AC2 6) chain A residue 76 type sequence G description BINDING SITE FOR RESIDUE SO4 A 131 source : AC2 7) chain A residue 83 type sequence H description BINDING SITE FOR RESIDUE SO4 A 131 source : AC2 8) chain A residue 46 type BINDING sequence H description BINDING => ECO:0000269|PubMed:3210236 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 112 type BINDING sequence C description BINDING => ECO:0000269|PubMed:3210236 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 117 type BINDING sequence H description BINDING => ECO:0000269|PubMed:3210236 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 121 type BINDING sequence H description BINDING => ECO:0000269|PubMed:3210236 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 105-120 type prosite sequence GEAYAYFCSFPGHWAM description COPPER_BLUE Type-1 copper (blue) proteins signature. GeaYaYFCsfPgHwa..M source prosite : PS00196

Display surface Download Links