eF-site ID 1a4a-A PDB Code 1a4a Chain A click to enlarge Title AZURIN MUTANT WITH MET 121 REPLACED BY HIS, PH 6.5 CRYSTAL FORM, DATA COLLECTED AT 16 DEGREES CELSIUS Classification ELECTRON TRANSPORT Compound AZURIN Source Achromobacter denitrificans (Alcaligenes denitrificans) (AZUR_ALCDE) Sequence A:  AQCEATIESNDAMQYDLKEMVVDKSCKQFTVHLKHVGKMA KSAMGHNWVLTKEADKEGVATDGMNAGLAQDYVKAGDTRV IAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAM HKGTLKLSN Description Functional site 1) chain A residue 46 type sequence H description BINDING SITE FOR RESIDUE CU A 130 source : AC1 2) chain A residue 112 type sequence C description BINDING SITE FOR RESIDUE CU A 130 source : AC1 3) chain A residue 117 type sequence H description BINDING SITE FOR RESIDUE CU A 130 source : AC1 4) chain A residue 121 type sequence H description BINDING SITE FOR RESIDUE CU A 130 source : AC1 5) chain A residue 46 type BINDING sequence H description BINDING => ECO:0000269|PubMed:3210236 source Swiss-Prot : SWS_FT_FI1 6) chain A residue 112 type BINDING sequence C description BINDING => ECO:0000269|PubMed:3210236 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 117 type BINDING sequence H description BINDING => ECO:0000269|PubMed:3210236 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 121 type BINDING sequence H description BINDING => ECO:0000269|PubMed:3210236 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 105-120 type prosite sequence GEAYAYFCSFPGHWAM description COPPER_BLUE Type-1 copper (blue) proteins signature. GeaYaYFCsfPgHwa..M source prosite : PS00196

Display surface Download Links