eF-site ID 1a38-A PDB Code 1a38 Chain A click to enlarge Title 14-3-3 PROTEIN ZETA BOUND TO R18 PEPTIDE Classification COMPLEX (SIGNAL TRANSDUCTION/PEPTIDE) Compound 14-3-3 PROTEIN ZETA Source null (1A38) Sequence A:  MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEE RNLLSVAYKNVVGARRSSWRVVSSIEQEKKQQMAREYREK IETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDY YRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHP IRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAESYK DSTLIMQLLRDNLTLW Description Functional site 1) chain A residue 1 type MOD_RES sequence M description N-acetylmethionine => ECO:0000250|UniProtKB:P63104 source Swiss-Prot : SWS_FT_FI2 2) chain A residue 3 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P63104 source Swiss-Prot : SWS_FT_FI3 3) chain A residue 58 type MOD_RES sequence S description Phosphoserine; by PKA => ECO:0000250|UniProtKB:P63104 source Swiss-Prot : SWS_FT_FI4 4) chain A residue 184 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P63104 source Swiss-Prot : SWS_FT_FI5 5) chain A residue 210 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P63102 source Swiss-Prot : SWS_FT_FI6 6) chain A residue 41-51 type prosite sequence RNLLSVAYKNV description 1433_1 14-3-3 proteins signature 1. RNLLSVAYKNV source prosite : PS00796 7) chain A residue 56 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000269|PubMed:18550856, ECO:0000269|PubMed:9632691 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 127 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000269|PubMed:18550856, ECO:0000269|PubMed:9632691 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links