eF-site ID 1a2x-AB PDB Code 1a2x Chain A, B click to enlarge Title COMPLEX OF TROPONIN C WITH A 47 RESIDUE (1-47) FRAGMENT OF TROPONIN I Classification COMPLEX (SKELETAL MUSCLE/MUSCLE PROTEIN) Compound TROPONIN C Source Oryctolagus cuniculus (Rabbit) (TNNI2_RABIT) Sequence A:  DQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGT VMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVR QMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRA SGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ B:  EEKRNRAITARRQHLKSVMLQIAATELEKEE Description Functional site 1) chain A residue 103 type sequence D description BINDING SITE FOR RESIDUE CA A 160 source : AC1 2) chain A residue 105 type sequence N description BINDING SITE FOR RESIDUE CA A 160 source : AC1 3) chain A residue 107 type sequence D description BINDING SITE FOR RESIDUE CA A 160 source : AC1 4) chain A residue 109 type sequence Y description BINDING SITE FOR RESIDUE CA A 160 source : AC1 5) chain A residue 114 type sequence E description BINDING SITE FOR RESIDUE CA A 160 source : AC1 6) chain A residue 139 type sequence D description BINDING SITE FOR RESIDUE CA A 161 source : AC2 7) chain A residue 141 type sequence N description BINDING SITE FOR RESIDUE CA A 161 source : AC2 8) chain A residue 143 type sequence D description BINDING SITE FOR RESIDUE CA A 161 source : AC2 9) chain A residue 145 type sequence R description BINDING SITE FOR RESIDUE CA A 161 source : AC2 10) chain A residue 150 type sequence E description BINDING SITE FOR RESIDUE CA A 161 source : AC2 11) chain A residue 27-39 type prosite sequence DADGGGDISVKEL description EF_HAND_1 EF-hand calcium-binding domain. DADGGGDISvkEL source prosite : PS00018 12) chain A residue 63-75 type prosite sequence DEDGSGTIDFEEF description EF_HAND_1 EF-hand calcium-binding domain. DADGGGDISvkEL source prosite : PS00018 13) chain A residue 103-115 type prosite sequence DRNADGYIDAEEL description EF_HAND_1 EF-hand calcium-binding domain. DADGGGDISvkEL source prosite : PS00018 14) chain A residue 139-151 type prosite sequence DKNNDGRIDFDEF description EF_HAND_1 EF-hand calcium-binding domain. DADGGGDISvkEL source prosite : PS00018 15) chain A residue 104 type MOD_RES sequence R description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 106 type MOD_RES sequence A description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 108 type MOD_RES sequence G description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 110 type MOD_RES sequence I description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 115 type MOD_RES sequence L description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 140 type MOD_RES sequence K description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 142 type MOD_RES sequence N description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 144 type MOD_RES sequence G description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 146 type MOD_RES sequence I description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 151 type MOD_RES sequence F description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 30 type MOD_RES sequence G description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 34 type MOD_RES sequence I description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 39 type MOD_RES sequence L description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 64 type MOD_RES sequence E description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 66 type MOD_RES sequence G description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 68 type MOD_RES sequence G description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 70 type MOD_RES sequence I description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 75 type MOD_RES sequence F description N-acetylglycine => ECO:0000269|PubMed:1180911 source Swiss-Prot : SWS_FT_FI1 33) chain B residue 12 type MOD_RES sequence A description Phosphothreonine; by PHK => ECO:0000269|PubMed:4369265, ECO:0000269|PubMed:4369337 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links