eF-site ID 1a2f-A PDB Code 1a2f Chain A click to enlarge Title PROBING THE STRENGTH AND CHARACTER OF AN ASP-HIS-X HYDROGEN BOND BY INTRODUCING BURIED CHARGES Classification OXIDOREDUCTASE Compound CYTOCHROME C PEROXIDASE Source null (CCPR_YEAST) Sequence A:  LVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYG PVLVRLAWHISGTWDKHDNTGGSYGGTYRFKKEFNDPSNA GLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPK IPWRCGRVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNM NDREVVALKGAHALGKTHLKNSGYEGPWGAANNVFTNEFY LNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPK YLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKDAPSP FIFKTLEEQGL Description Functional site 1) chain A residue 48 type sequence R description LYS SUBSTITUTES THE MET 172 - FORMS A NEW SALT BRIDGE TO ASP 235. source : AVE 2) chain A residue 51 type sequence W description LYS SUBSTITUTES THE MET 172 - FORMS A NEW SALT BRIDGE TO ASP 235. source : AVE 3) chain A residue 52 type sequence H description LYS SUBSTITUTES THE MET 172 - FORMS A NEW SALT BRIDGE TO ASP 235. source : AVE 4) chain A residue 44 type sequence P description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 5) chain A residue 51 type sequence W description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 6) chain A residue 146 type sequence D description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 7) chain A residue 171 type sequence L description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 8) chain A residue 172 type sequence K description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 9) chain A residue 174 type sequence A description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 10) chain A residue 175 type sequence H description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 11) chain A residue 177 type sequence L description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 12) chain A residue 178 type sequence G description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 13) chain A residue 179 type sequence K description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 14) chain A residue 180 type sequence T description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 15) chain A residue 181 type sequence H description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 16) chain A residue 184 type sequence N description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 17) chain A residue 185 type sequence S description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 18) chain A residue 191 type sequence W description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 19) chain A residue 234 type sequence T description BINDING SITE FOR RESIDUE HEM A 1 source : AC1 20) chain A residue 48 type catalytic sequence R description 709 source MCSA : MCSA1 21) chain A residue 52 type catalytic sequence H description 709 source MCSA : MCSA1 22) chain A residue 191 type catalytic sequence W description 709 source MCSA : MCSA1 23) chain A residue 153 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI5 24) chain A residue 43-54 type prosite sequence GPVLVRLAWHIS description PEROXIDASE_2 Peroxidases active site signature. GPvlVRLaWHIS source prosite : PS00436 25) chain A residue 52 type ACT_SITE sequence H description Proton acceptor source Swiss-Prot : SWS_FT_FI1 26) chain A residue 191 type ACT_SITE sequence W description Tryptophan radical intermediate source Swiss-Prot : SWS_FT_FI2 27) chain A residue 175 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI3 28) chain A residue 48 type SITE sequence R description Transition state stabilizer source Swiss-Prot : SWS_FT_FI4

Display surface Download Links