eF-site ID 1a1j-ABC PDB Code 1a1j Chain A, B, C click to enlarge Title RADR (ZIF268 VARIANT) ZINC FINGER-DNA COMPLEX (GCGT SITE) Classification TRANSCRIPTION/DNA Compound DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3') Source (1A1J) Sequence A:  RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMR NFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHT KIHL B:  AGCGTGGGCGT C:  TACGCCCACGC Description Functional site 1) chain A residue 107 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 2) chain A residue 112 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 3) chain A residue 125 type sequence H description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 4) chain A residue 129 type sequence H description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 5) chain A residue 137 type sequence C description BINDING SITE FOR RESIDUE ZN A 202 source : AC2 6) chain A residue 140 type sequence C description BINDING SITE FOR RESIDUE ZN A 202 source : AC2 7) chain A residue 153 type sequence H description BINDING SITE FOR RESIDUE ZN A 202 source : AC2 8) chain A residue 157 type sequence H description BINDING SITE FOR RESIDUE ZN A 202 source : AC2 9) chain A residue 165 type sequence C description BINDING SITE FOR RESIDUE ZN A 203 source : AC3 10) chain A residue 168 type sequence C description BINDING SITE FOR RESIDUE ZN A 203 source : AC3 11) chain A residue 181 type sequence H description BINDING SITE FOR RESIDUE ZN A 203 source : AC3 12) chain A residue 185 type sequence H description BINDING SITE FOR RESIDUE ZN A 203 source : AC3 13) chain A residue 107-129 type prosite sequence CPVESCDRRFSRSADLTRHIRIH description ZINC_FINGER_C2H2_1 Zinc finger C2H2 type domain signature. CpvesCdrrFsrsadltrHiri..H source prosite : PS00028 14) chain A residue 137-157 type prosite sequence CRICMRNFSRSDHLTTHIRTH description ZINC_FINGER_C2H2_1 Zinc finger C2H2 type domain signature. CpvesCdrrFsrsadltrHiri..H source prosite : PS00028 15) chain A residue 165-185 type prosite sequence CDICGRKFARSDERKRHTKIH description ZINC_FINGER_C2H2_1 Zinc finger C2H2 type domain signature. CpvesCdrrFsrsadltrHiri..H source prosite : PS00028 16) chain A residue 130-154 type ZN_FING sequence TGQKPFQCRICMRNFSRSDHLTTHI description C2H2-type 1 => ECO:0000255|PROSITE-ProRule:PRU00042 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 160-182 type ZN_FING sequence EKPFACDICGRKFARSDERKRHT description C2H2-type 2 => ECO:0000255|PROSITE-ProRule:PRU00042 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 128 type SITE sequence I description Interaction with DNA => ECO:0000269|PubMed:2028256, ECO:0000269|PubMed:8939742, ECO:0007744|PDB:1AAY, ECO:0007744|PDB:1ZAA source Swiss-Prot : SWS_FT_FI3 19) chain A residue 139 type SITE sequence I description Interaction with DNA => ECO:0000269|PubMed:2028256, ECO:0000269|PubMed:8939742, ECO:0007744|PDB:1AAY, ECO:0007744|PDB:1ZAA source Swiss-Prot : SWS_FT_FI3 20) chain A residue 143 type SITE sequence N description Interaction with DNA => ECO:0000269|PubMed:2028256, ECO:0000269|PubMed:8939742, ECO:0007744|PDB:1AAY, ECO:0007744|PDB:1ZAA source Swiss-Prot : SWS_FT_FI3 21) chain A residue 149 type SITE sequence H description Interaction with DNA => ECO:0000269|PubMed:2028256, ECO:0000269|PubMed:8939742, ECO:0007744|PDB:1AAY, ECO:0007744|PDB:1ZAA source Swiss-Prot : SWS_FT_FI3 22) chain A residue 167 type SITE sequence I description Interaction with DNA => ECO:0000269|PubMed:2028256, ECO:0000269|PubMed:8939742, ECO:0007744|PDB:1AAY, ECO:0007744|PDB:1ZAA source Swiss-Prot : SWS_FT_FI3 23) chain A residue 171 type SITE sequence K description Interaction with DNA => ECO:0000269|PubMed:2028256, ECO:0000269|PubMed:8939742, ECO:0007744|PDB:1AAY, ECO:0007744|PDB:1ZAA source Swiss-Prot : SWS_FT_FI3

Display surface Download Links