eF-site ID 1a15-A PDB Code 1a15 Chain A click to enlarge Title SDF-1ALPHA Classification CHEMOKINE Compound STROMAL DERIVED FACTOR-1ALPHA Source Homo sapiens (Human) (SDF1_HUMAN) Sequence A:  KPVSLSYRCPCRFFESHVARANVKHLKILNTPACALQIVA RLKNNNRQVCIDPKLKWIQEYLEKALN Description Functional site 1) chain A residue 19 type sequence A description BINDING SITE FOR RESIDUE SO4 A 0 source : AC1 2) chain A residue 20 type sequence R description BINDING SITE FOR RESIDUE SO4 A 0 source : AC1 3) chain A residue 21 type sequence A description BINDING SITE FOR RESIDUE SO4 A 0 source : AC1 4) chain A residue 20 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 5) chain A residue 41 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 6) chain A residue 48 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 7) chain A residue 64 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI1 8) chain A residue 24 type SITE sequence K description Important for integrin interaction and activation => ECO:0000269|PubMed:29301984 source Swiss-Prot : SWS_FT_FI2 9) chain A residue 27 type SITE sequence K description Important for integrin interaction and activation => ECO:0000269|PubMed:29301984 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 43 type SITE sequence K description Important for integrin interaction and activation => ECO:0000269|PubMed:29301984 source Swiss-Prot : SWS_FT_FI2 11) chain A residue 25 type SITE sequence H description Important for dimer formation source Swiss-Prot : SWS_FT_FI3

Display surface Download Links