eF-site ID 1a0i-A PDB Code 1a0i Chain A click to enlarge Title ATP-DEPENDENT DNA LIGASE FROM BACTERIOPHAGE T7 COMPLEX WITH ATP Classification LIGASE Compound DNA LIGASE Source null (DNLI_BPT7) Sequence A:  VNIKTNPFKAVSFVESAIKKALDNAGYLIAEIKYDGVRGN ICVDNTANSYWLSRVSKTIPALEHLNGFDVRWKRLLNDDR CFYKDGFMLDGELMVKGVDFNTGSGLLRTKWTDTKNQEFH RKKDKVPFKLHTGHLHIKLYAILPLHIVESGEDCDVMTLL MQEHVKNMLPLLQEYFPEIEWQAAESYEVYDMVELQQLYE QKRAEGHEGLIVKDPMCIYKRGKKSGWWKMKPENEADGII QGLVWGTKGLANEGKVIGFEVLLESGRLVNATNISRALMD EFTETVKEATLSQWGFFDACTINPYDGWACQISYMEETPD GSLRHPSFVMFR Description Functional site 1) chain A residue 32 type sequence E description BINDING SITE FOR RESIDUE ATP A 1 source : AC1 2) chain A residue 33 type sequence I description BINDING SITE FOR RESIDUE ATP A 1 source : AC1 3) chain A residue 34 type sequence K description BINDING SITE FOR RESIDUE ATP A 1 source : AC1 4) chain A residue 35 type sequence Y description BINDING SITE FOR RESIDUE ATP A 1 source : AC1 5) chain A residue 39 type sequence R description BINDING SITE FOR RESIDUE ATP A 1 source : AC1 6) chain A residue 55 type sequence R description BINDING SITE FOR RESIDUE ATP A 1 source : AC1 7) chain A residue 93 type sequence E description BINDING SITE FOR RESIDUE ATP A 1 source : AC1 8) chain A residue 149 type sequence Y description BINDING SITE FOR RESIDUE ATP A 1 source : AC1 9) chain A residue 220 type sequence I description BINDING SITE FOR RESIDUE ATP A 1 source : AC1 10) chain A residue 222 type sequence K description BINDING SITE FOR RESIDUE ATP A 1 source : AC1 11) chain A residue 232 type sequence K description BINDING SITE FOR RESIDUE ATP A 1 source : AC1 12) chain A residue 236 type sequence W description BINDING SITE FOR RESIDUE ATP A 1 source : AC1 13) chain A residue 238 type sequence K description BINDING SITE FOR RESIDUE ATP A 1 source : AC1 14) chain A residue 34 type catalytic sequence K description 202 source MCSA : MCSA1 15) chain A residue 238 type catalytic sequence K description 202 source MCSA : MCSA1 16) chain A residue 240 type catalytic sequence K description 202 source MCSA : MCSA1 17) chain A residue 34 type ACT_SITE sequence K description N6-AMP-lysine intermediate => ECO:0000255|PROSITE-ProRule:PRU10135 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 32 type BINDING sequence E description BINDING => ECO:0000269|PubMed:8653795 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 39 type BINDING sequence R description BINDING => ECO:0000269|PubMed:8653795 source Swiss-Prot : SWS_FT_FI2 20) chain A residue 55 type BINDING sequence R description BINDING => ECO:0000269|PubMed:8653795 source Swiss-Prot : SWS_FT_FI2 21) chain A residue 93 type BINDING sequence E description BINDING => ECO:0000269|PubMed:8653795 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 232 type BINDING sequence K description BINDING => ECO:0000269|PubMed:8653795 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 217 type BINDING sequence E description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 24) chain A residue 217-240 type prosite sequence EGLIVKDPMCIYKRGKKSGWWKMK description DNA_LIGASE_A2 ATP-dependent DNA ligase signature 2. EGLIVKdpmci...YKrgk...Ksgww.KMK source prosite : PS00333 25) chain A residue 32-40 type prosite sequence EIKYDGVRG description DNA_LIGASE_A1 ATP-dependent DNA ligase AMP-binding site. EIKYDGVRG source prosite : PS00697 26) chain A residue 238 type BINDING sequence K description BINDING => ECO:0000305|PubMed:8653795 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links