eF-site ID 108m-A
PDB Code 108m
Chain A

click to enlarge
Title SPERM WHALE MYOGLOBIN V68F N-BUTYL ISOCYANIDE AT PH 7.0
Classification OXYGEN TRANSPORT
Compound MYOGLOBIN
Source Physeter catodon (Sperm whale) (Physeter macrocephalus) (MYG_PHYCA)
Sequence A:  MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPET
LEKFDRFKHLKTEAEMKASEDLKKHGVTFLTALGAILKKK
GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH
PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
Description (1)  MYOGLOBIN, PROTOPORPHYRIN IX CONTAINING FE, N-BUTYL ISOCYANIDE


Functional site

1) chain A
residue 3
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 157
source : AC1

2) chain A
residue 4
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 157
source : AC1

3) chain A
residue 51
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 A 157
source : AC1

4) chain A
residue 52
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 157
source : AC1

5) chain A
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM A 155
source : AC2

6) chain A
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 155
source : AC2

7) chain A
residue 45
type
ligand
sequence R
description BINDING SITE FOR RESIDUE HEM A 155
source : AC2

8) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 155
source : AC2

9) chain A
residue 68
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 155
source : AC2

10) chain A
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 155
source : AC2

11) chain A
residue 92
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM A 155
source : AC2

12) chain A
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 155
source : AC2

13) chain A
residue 97
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 155
source : AC2

14) chain A
residue 99
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM A 155
source : AC2

15) chain A
residue 103
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM A 155
source : AC2

16) chain A
residue 138
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 155
source : AC2

17) chain A
residue 29
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NBN A 156
source : AC3

18) chain A
residue 32
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NBN A 156
source : AC3

19) chain A
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE NBN A 156
source : AC3

20) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NBN A 156
source : AC3

21) chain A
residue 68
type
ligand
sequence F
description BINDING SITE FOR RESIDUE NBN A 156
source : AC3

22) chain A
residue 107
type
ligand
sequence I
description BINDING SITE FOR RESIDUE NBN A 156
source : AC3

23) chain A
residue 65
type METAL
ligand
sequence G
description Iron (heme distal ligand). {ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:845959}
source Swiss-Prot : SWS_FT_FI1

24) chain A
residue 94
type METAL
ligand
sequence A
description Iron (heme proximal ligand). {ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:845959}
source Swiss-Prot : SWS_FT_FI2

25) chain A
residue 29
type binding
ligand NBN: N-BUTYL ISOCYANIDE
sequence L
description N-BUTYL ISOCYANIDE binding site
source pdb_hetatom : NBN_108m_A_156

26) chain A
residue 32-33
type binding
ligand NBN: N-BUTYL ISOCYANIDE
sequence LF
description N-BUTYL ISOCYANIDE binding site
source pdb_hetatom : NBN_108m_A_156

27) chain A
residue 43
type binding
ligand NBN: N-BUTYL ISOCYANIDE
sequence F
description N-BUTYL ISOCYANIDE binding site
source pdb_hetatom : NBN_108m_A_156

28) chain A
residue 64
type binding
ligand NBN: N-BUTYL ISOCYANIDE
sequence H
description N-BUTYL ISOCYANIDE binding site
source pdb_hetatom : NBN_108m_A_156

29) chain A
residue 67-68
type binding
ligand NBN: N-BUTYL ISOCYANIDE
sequence TF
description N-BUTYL ISOCYANIDE binding site
source pdb_hetatom : NBN_108m_A_156

30) chain A
residue 93
type binding
ligand NBN: N-BUTYL ISOCYANIDE
sequence H
description N-BUTYL ISOCYANIDE binding site
source pdb_hetatom : NBN_108m_A_156

31) chain A
residue 107
type binding
ligand NBN: N-BUTYL ISOCYANIDE
sequence I
description N-BUTYL ISOCYANIDE binding site
source pdb_hetatom : NBN_108m_A_156

32) chain A
residue 32
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

33) chain A
residue 39
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence T
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

34) chain A
residue 42-43
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence KF
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

35) chain A
residue 45
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence R
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

36) chain A
residue 64
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

37) chain A
residue 67-68
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence TF
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

38) chain A
residue 71-72
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence AL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

39) chain A
residue 75
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

40) chain A
residue 88-89
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence PL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

41) chain A
residue 92-93
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence SH
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

42) chain A
residue 97
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

43) chain A
residue 99
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

44) chain A
residue 103-104
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence YL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

45) chain A
residue 107
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155

46) chain A
residue 138
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_108m_A_155


Display surface

Download
Links