eF-site ID 108l-A
PDB Code 108l
Chain A

click to enlarge
Title STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
Classification HYDROLASE(O-GLYCOSYL)
Compound T4 LYSOZYME
Source Enterobacteria phage T4 (Bacteriophage T4) (LYCV_BPT4)
Sequence A:  MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLN
AAKIELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRM
LQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YK
Description (1)  LYSOZYME (E.C.3.2.1.17) MUTANT WITH SER 44 REPLACED BY ILE, CYS 54 REPLACED BY THR, CYS 97 REPLACED BY ALA (S44I,C54T, C97A)


Functional site

1) chain A
residue 124
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CL A 173
source : AC1

2) chain A
residue 142
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL A 173
source : AC1

3) chain A
residue 144
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CL A 173
source : AC1

4) chain A
residue 145
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CL A 173
source : AC1

5) chain A
residue 135
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CL A 178
source : AC2

6) chain A
residue 72
type
ligand
sequence D
description BINDING SITE FOR RESIDUE BME A 901
source : AC3

7) chain A
residue 68
type
ligand
sequence N
description BINDING SITE FOR RESIDUE BME A 902
source : AC4

8) chain A
residue 93
type
ligand
sequence A
description BINDING SITE FOR RESIDUE BME A 902
source : AC4

9) chain A
residue 100
type
ligand
sequence I
description BINDING SITE FOR RESIDUE BME A 902
source : AC4

10) chain A
residue 11
type ACT_SITE
ligand
sequence E
description Proton donor. {ECO:0000255|HAMAP- Rule:MF_04110, ECO:0000269|PubMed:3382407}.
source Swiss-Prot : SWS_FT_FI1

11) chain A
residue 20
type ACT_SITE
ligand
sequence D
description Nucleophile. {ECO:0000255|HAMAP- Rule:MF_04110, ECO:0000269|PubMed:1892846, ECO:0000269|PubMed:3382407}.
source Swiss-Prot : SWS_FT_FI2

12) chain A
residue 32
type BINDING
ligand
sequence L
description N-acetyl-D-glucosamine; via amide nitrogen. {ECO:0000255|HAMAP- Rule:MF_04110, ECO:0000269|PubMed:8266098}.
source Swiss-Prot : SWS_FT_FI3

13) chain A
residue 104
type BINDING
ligand
sequence F
description N-acetyl-D-glucosamine; via amide nitrogen. {ECO:0000255|HAMAP- Rule:MF_04110, ECO:0000269|PubMed:8266098}.
source Swiss-Prot : SWS_FT_FI3

14) chain A
residue 117
type SITE
ligand
sequence S
description Substrate-binding. {ECO:0000303|PubMed:7831309}.
source Swiss-Prot : SWS_FT_FI4

15) chain A
residue 132
type SITE
ligand
sequence N
description Substrate-binding. {ECO:0000303|PubMed:7831309}.
source Swiss-Prot : SWS_FT_FI4

16) chain A
residue 3
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence I
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_108l_A_902

17) chain A
residue 88
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence Y
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_108l_A_902

18) chain A
residue 93-94
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence AV
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_108l_A_902

19) chain A
residue 96-97
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence RA
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_108l_A_902

20) chain A
residue 100
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence I
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_108l_A_902

21) chain A
residue 158
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence W
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_108l_A_902

22) chain A
residue 3-4
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence IF
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_108l_A_901

23) chain A
residue 75
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence V
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_108l_A_901

24) chain A
residue 88
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence Y
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_108l_A_901

25) chain A
residue 100
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence I
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_108l_A_901

26) chain A
residue 11
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 206l
source CSA : CSA1

27) chain A
residue 20
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 206l
source CSA : CSA1


Display surface

Download
Links