eF-site ID 104l-A
PDB Code 104l
Chain A

click to enlarge
Title HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME
Classification HYDROLASE(O-GLYCOSYL)
Compound T4 LYSOZYME
Source Enterobacteria phage T4 (Bacteriophage T4) (LYS_BPT4)
Sequence A:  MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLN
AAKSAAELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGI
LRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSL
RMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTW
DAYK
Description (1)  LYSOZYME INSERTION MUTANT WITH ALA, ALA INSERTED AFTER SER 44, CYS 54 REPLACED BY THR, CYS 97 REPLACED BY ALA (INS(S44-AA),C54T,C97A)


Functional site

1) chain A
residue 11
type ACT_SITE
ligand
sequence E
description Proton donor.
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 20
type ACT_SITE
ligand
sequence D
description Nucleophile.
source Swiss-Prot : SWS_FT_FI2

3) chain A
residue 11
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 206l
source CSA : CSA1

4) chain A
residue 20
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 206l
source CSA : CSA1


Display surface

Download
Links