Sequence (fasta): 6r9oDownload

>6R9OA:PAN2-PAN3 deadenylation complex catalytic subunit PAN2
MHHHHHHHHLEVLFQGPTSDIQTYTSINKYEVPPAYSRLPLTSGRFGTDNFDFTPFNNTE
YSGLDPDVDNHYTNAIIQLYRFIPEMFNFVVGCLKDENFETTLLTDLGYLFDMMERSHGK
ICSSSNFQASLKSLTDKRQLENGEPQEHLEEYLESLCIRESIEDFNSSESIKRNMPQKFN
RFLLSQLIKEEAQTVNHNITLNQCFGLETEIRTECSCDHYDTTVKLLPSLSISGINKTVI
KQLNKKSNGQNILPYIEYAMKNVTQKNSICPTCGKTETITQECTVKNLPSVLSLELSLLD
TEFSNIRSSKNWLTSEFYGSIIKNKAVLRSTASELKGTSHIFKYELNGYVAKITDNNNET
RLVTYVKKYNPKENCFKWLMFNDYLVVEITEEEALKMTYPWKTPEIIIYCDAEELRKPFF
SVDTYSINYDILFRDYFANGIRDTARREYKLLTHDEAPKSGTLVAIDAAFVSLQSELCEI
DHQGIRSIIRPKRTALARISIIRGEEGELYGVPFVDDYVVNTNHIEDYLTRYSGILPGDL
DPEKSTKRLVRRNVVYRKVWLLMQLGCVFVGHGLNNDFKHININVPRNQIRDTAIYFLQG
KRYLSLRYLAYVLLGMNIQEGNHDSIEDAHTALILYKKYLHLKEKAIFEKVLNSVYEEGR
AHNFKVPETSKG
>6R9OB:AAGGA RNA
AAGGA