Sequence (fasta): 6r83Download

>6R831a:Hemocyanin subunit 1
NLLRKNVDTLTPDEILNLQVSLRAMQDDEGASGYQAISAYHGEPADCKAADGSTIVCCLH
GMPTFPMWHRLYLVQFEQALVAHGSTLGIPYWDWTKPMTQLPELVQHPLFIDPTGKKAKK
NVFYSGEIKFENKVTARAVDARLYQASQEGQKNFLLEGVLNALEQEDFCHFEVQLEVAHN
PIHYLVGGRFTHSMSSLEYTSYDPLFFLHHSNVERHFALWQALQKHRGLPTRPNCGLNLF
HSPMEPFGRDTNPFAITKDNSKASSLFDYEHLGYAFDDLSLNGMTIEELEALLKQRRSGA
RAFANFRLGGIKTSANVRIKLCIPTEDKRQSDNCDNDAGQFFILGGTNEMPWNFAFPYLH
EITDTVLSLGLALDSNYYVTAEVTAINGTLMPTQTIPRPIVTYIPPQGFKDVNMVNMDTS
SLRFRKDISSLTTEEEYELRVAMERFMSDKSINGYQALAEFHGLPAKCPRPDALNRVACC
IHGMATFPHWHRLVVMQFENALFTRGSPIGVPYWDWTKPFTALPSLLADETYVDPYTKET
KPNPFFKAPIEFLKAGVHTSRQIDERLFKQPSKGDHGFLYDGLSLAFEQDDFCDFEVQFE
VTHNSIHAWTGGSEPYSMSSLHYTSFDPMFWLHHSQVDRLWAIWQALQIQRGKPYKTYCA
NSEVYRPMKPFAFKSPLNNDEKTREHSVPTDVYDYQAELAYTYDTLFFGGLSIRELQRYV
EEAKSKDRVFAGFLLMGIQTSANVDLFVVAGGNEFFVGSIAVLGGSKEMTWRFDRVYKHE
ITDALGALGVDMFAEYTLRVDIKDVNGTALPPTAIPPPIVIFVPGIADANVKFDEQHRSR
KNVDSMTVSEMNALRTAMAAFAADKEVTGYQQVAAFHGSTQWCPSPDAAQKYACCHHGMA
TFPHWHRLIALNFENGLRRNGWSGGLPYWDWTRPIDALPALVLEAEYTDANGEAKPNPFF
SGAIDSIGASTSRAPTEALYEKPDFGKYTHLANEIISALEQEDFCDFEVQYEIAHNHIHA
LVGGTEAVSMASLEYSAFDPIFMLHHSNVDRIWATWQALQKFRGKAYNSANCAIEILRKP
MSPFSLASDINPDAMTREYSVPFDVFNYKKNFHYEYDTLELNGLSIXQLSREINRRKAKN
RVXVTFMLEGLKKSLLVEYFIAADGTDQKMKAGEFYVLGSENEMPWKFDRPYKSDITYVM
DAMKLHYTDKYHVELRITDMTGAEVTDLKLVTSVIYEPGIGNFGEGRRWISPITSASRIR
KNLLDFEDGEMESLRNAFKQMADEGRYEEIASFHGVPAQCPSEDGTMVHTCCLHGMPVFP
HWHRLYVSLVEDELLARGSGVAVPYWDWVEPFDELPRLINEATFYNSRTLQIEPNPFFKG
KISFENAETDRDTQPELFGNRYLYDHTLFVFEQTDFCEFEVHYEVLHNTIHSWLGGRDVH
SMSSLDYAAYDPVFFLHHSNVDRLWAIWQELQRYRKLSYNEANCALPLMNQPMRPFSNST
ANNDRLTFTNSRPNDVFDYQNVLHYKYDTLNFAGLSIPQLERILQKNQGRDRIFAGFLLH
GIKASADVRIYICVPTGIGEENCGNYAGIFSVLGGETEMPWQFDRLFRYEITDELKKLGL
NQNSHFRVEMELTAVNGSKITQKIFPNPTIIFVPSDVEFEEDTWRDVVTSANRIRRNLKD
LSKEDMFSLRAAFKRMTDDGRYEEIAAFHGLPAQCPNADGSNIHTCCLHGMPTFPHWHRL
YLSLVENELLARGSDVAVPYWDWIEPFDSLPGLISDETYKHPKTNEDIENPFHHGKISFA
DAVTVRKPRDQLFNNRYLYEHALFAFEHTDFCDFEVHFEVLHNSIHSWIGGPNPHSMSSL
DFAAYDPIFFLHHSTVDRLWAIWQDLQRYRKLDYNVANCALNLLNDPMRPFNNKTANQDH
LTFTNSRPNDVFDYQNSLNYKFDSLSFSGLSIPRLDDLLESRQSHDRVFAGFWLSGIKAS
ADVNIHICVPIGVEHEDCDNYAGTFAVLGGETEMPWAFDRLFRYEISDEMKKLQLTEDSK
FRLTTNIIASNGSKVSNDIFPTPTVIFVPKKERTEQVSTTKSVRGNLVRKNVDRLSLQEI
NSLIHALKRMQKDRSSDGFETIASFHALPPLCPNPTAKHRHACCLHGMATFPQWHRLYVV
QFEHSLNRHGAIVGVPYWDWTYPMTEVPGLLTSEKYTDPFTGIETFNPFNHGHISFISPE
TMTTREVSEHLFEQPALGKQTWLFNNIILALEQTDYCDFEVQFEIVHNSIHSWLGGKELY
SLNHLHYAAYDPAFFLHHSNVDRLWVVWQELQKFRGLPAYESNCAIELMSQPLKPFSFGA
PYNLNPVTTKYSKPSDVFNYKQNFHYEYDMLEMNGMSIAQLESYIRQERQKDRVFAGFLL
EGFGSSAYATFQVCPDVGDCYEGSHFSVLGGSTEMPWAFDRLYKMEITDILQAMDLKFDS
HFTIKTKIVAHNGTELPESLLPEATIVRIPPSAQNLEVAIPLNRIRRNINSLESRDVQNL
MSALKRLKEDESDFGFQTIAGYHGSLMCPTPEAPEYACCLHGMPTFMHWHRVYLLHFEES
MRRHGASVAVPYWDWTMPSDNLPSLLGDADYYDAWTDSVIENPFLRGHIKYEDTYTVREI
QPELFALAEGQKESTLFKDVMLMFEQEDYCDFEVQAEVIHNSIHYLIGGHQKYAMSSLMF
SSFDPIFYVHHSMVDRLWAIWQELQKHRKLPHDKAYCALDQMAFPMKPFIWESNPNPTTR
AVSTPSKLFDYKSLGYDYDHLNFHGMSIGQLEALIQKQKKADRVFAGFLLHGIKISADVH
LKICIEADCQEAGVIFVLGGETEMPWHFDRNYKMDITDVLKKRNIPPEALFEHDSKIRLE
VEIKSVDGAVLDPNSLPKPSLIYAPAKGLIIQQVGEYDAGSMVRKNVNSLTPSEIENLRN
ALAAVQADKTDAGYQKIASFHGMPLSCQYPDGTAFACCQHGMVTFPHWHRLYMKQMEDAL
KAKGAKIGIPYWDWTTAFHSLPILVTEPKNNPFHHGYIDVADTKTTRDPRPQLFDDPEQG
DQSFFYRQIAFALEQRDFCDFEIQFEMGHNAIHSWVGGPSPYGMSTLHYTSYDPLFYVHH
SNTDRIWAIWQALQKYRGLPYNSANCEINKLKKPMMPFSSEDNPNEVTKAHSTGYKSFDY
QQLNYEYDNLNFHGMTIPQLEVHLKKIQEKDRVFAGFLLRAIGQSADVNFDVCRKDGECT
FGGTFCVLGGDYEMPWAFDRLFLYDISKSLVHLRLDAHDDFDIKVTIMGIDGKSLPPNLL
PSPTILFKPGTGKI
>6R832a:Hemocyanin subunit 1
NLLRKNVDTLTPDEILNLQVSLRAMQDDEGASGYQAISAYHGEPADCKAADGSTIVCCLH
GMPTFPMWHRLYLVQFEQALVAHGSTLGIPYWDWTKPMTQLPELVQHPLFIDPTGKKAKK
NVFYSGEIKFENKVTARAVDARLYQASQEGQKNFLLEGVLNALEQEDFCHFEVQLEVAHN
PIHYLVGGRFTHSMSSLEYTSYDPLFFLHHSNVERHFALWQALQKHRGLPTRPNCGLNLF
HSPMEPFGRDTNPFAITKDNSKASSLFDYEHLGYAFDDLSLNGMTIEELEALLKQRRSGA
RAFANFRLGGIKTSANVRIKLCIPTEDKRQSDNCDNDAGQFFILGGTNEMPWNFAFPYLH
EITDTVLSLGLALDSNYYVTAEVTAINGTLMPTQTIPRPIVTYIPPQGFKDVNMVNMDTS
SLRFRKDISSLTTEEEYELRVAMERFMSDKSINGYQALAEFHGLPAKCPRPDALNRVACC
IHGMATFPHWHRLVVMQFENALFTRGSPIGVPYWDWTKPFTALPSLLADETYVDPYTKET
KPNPFFKAPIEFLKAGVHTSRQIDERLFKQPSKGDHGFLYDGLSLAFEQDDFCDFEVQFE
VTHNSIHAWTGGSEPYSMSSLHYTSFDPMFWLHHSQVDRLWAIWQALQIQRGKPYKTYCA
NSEVYRPMKPFAFKSPLNNDEKTREHSVPTDVYDYQAELAYTYDTLFFGGLSIRELQRYV
EEAKSKDRVFAGFLLMGIQTSANVDLFVVAGGNEFFVGSIAVLGGSKEMTWRFDRVYKHE
ITDALGALGVDMFAEYTLRVDIKDVNGTALPPTAIPPPIVIFVPGIADANVKFDEQHRSR
KNVDSMTVSEMNALRTAMAAFAADKEVTGYQQVAAFHGSTQWCPSPDAAQKYACCHHGMA
TFPHWHRLIALNFENGLRRNGWSGGLPYWDWTRPIDALPALVLEAEYTDANGEAKPNPFF
SGAIDSIGASTSRAPTEALYEKPDFGKYTHLANEIISALEQEDFCDFEVQYEIAHNHIHA
LVGGTEAVSMASLEYSAFDPIFMLHHSNVDRIWATWQALQKFRGKAYNSANCAIEILRKP
MSPFSLASDINPDAMTREYSVPFDVFNYKKNFHYEYDTLELNGLSIXQLSREINRRKAKN
RVXVTFMLEGLKKSLLVEYFIAADGTDQKMKAGEFYVLGSENEMPWKFDRPYKSDITYVM
DAMKLHYTDKYHVELRITDMTGAEVTDLKLVTSVIYEPGIGNFGEGRRWISPITSASRIR
KNLLDFEDGEMESLRNAFKQMADEGRYEEIASFHGVPAQCPSEDGTMVHTCCLHGMPVFP
HWHRLYVSLVEDELLARGSGVAVPYWDWVEPFDELPRLINEATFYNSRTLQIEPNPFFKG
KISFENAETDRDTQPELFGNRYLYDHTLFVFEQTDFCEFEVHYEVLHNTIHSWLGGRDVH
SMSSLDYAAYDPVFFLHHSNVDRLWAIWQELQRYRKLSYNEANCALPLMNQPMRPFSNST
ANNDRLTFTNSRPNDVFDYQNVLHYKYDTLNFAGLSIPQLERILQKNQGRDRIFAGFLLH
GIKASADVRIYICVPTGIGEENCGNYAGIFSVLGGETEMPWQFDRLFRYEITDELKKLGL
NQNSHFRVEMELTAVNGSKITQKIFPNPTIIFVPSDVEFEEDTWRDVVTSANRIRRNLKD
LSKEDMFSLRAAFKRMTDDGRYEEIAAFHGLPAQCPNADGSNIHTCCLHGMPTFPHWHRL
YLSLVENELLARGSDVAVPYWDWIEPFDSLPGLISDETYKHPKTNEDIENPFHHGKISFA
DAVTVRKPRDQLFNNRYLYEHALFAFEHTDFCDFEVHFEVLHNSIHSWIGGPNPHSMSSL
DFAAYDPIFFLHHSTVDRLWAIWQDLQRYRKLDYNVANCALNLLNDPMRPFNNKTANQDH
LTFTNSRPNDVFDYQNSLNYKFDSLSFSGLSIPRLDDLLESRQSHDRVFAGFWLSGIKAS
ADVNIHICVPIGVEHEDCDNYAGTFAVLGGETEMPWAFDRLFRYEISDEMKKLQLTEDSK
FRLTTNIIASNGSKVSNDIFPTPTVIFVPKKERTEQVSTTKSVRGNLVRKNVDRLSLQEI
NSLIHALKRMQKDRSSDGFETIASFHALPPLCPNPTAKHRHACCLHGMATFPQWHRLYVV
QFEHSLNRHGAIVGVPYWDWTYPMTEVPGLLTSEKYTDPFTGIETFNPFNHGHISFISPE
TMTTREVSEHLFEQPALGKQTWLFNNIILALEQTDYCDFEVQFEIVHNSIHSWLGGKELY
SLNHLHYAAYDPAFFLHHSNVDRLWVVWQELQKFRGLPAYESNCAIELMSQPLKPFSFGA
PYNLNPVTTKYSKPSDVFNYKQNFHYEYDMLEMNGMSIAQLESYIRQERQKDRVFAGFLL
EGFGSSAYATFQVCPDVGDCYEGSHFSVLGGSTEMPWAFDRLYKMEITDILQAMDLKFDS
HFTIKTKIVAHNGTELPESLLPEATIVRIPPSAQNLEVAIPLNRIRRNINSLESRDVQNL
MSALKRLKEDESDFGFQTIAGYHGSLMCPTPEAPEYACCLHGMPTFMHWHRVYLLHFEES
MRRHGASVAVPYWDWTMPSDNLPSLLGDADYYDAWTDSVIENPFLRGHIKYEDTYTVREI
QPELFALAEGQKESTLFKDVMLMFEQEDYCDFEVQAEVIHNSIHYLIGGHQKYAMSSLMF
SSFDPIFYVHHSMVDRLWAIWQELQKHRKLPHDKAYCALDQMAFPMKPFIWESNPNPTTR
AVSTPSKLFDYKSLGYDYDHLNFHGMSIGQLEALIQKQKKADRVFAGFLLHGIKISADVH
LKICIEADCQEAGVIFVLGGETEMPWHFDRNYKMDITDVLKKRNIPPEALFEHDSKIRLE
VEIKSVDGAVLDPNSLPKPSLIYAPAKGLIIQQVGEYDAGSMVRKNVNSLTPSEIENLRN
ALAAVQADKTDAGYQKIASFHGMPLSCQYPDGTAFACCQHGMVTFPHWHRLYMKQMEDAL
KAKGAKIGIPYWDWTTAFHSLPILVTEPKNNPFHHGYIDVADTKTTRDPRPQLFDDPEQG
DQSFFYRQIAFALEQRDFCDFEIQFEMGHNAIHSWVGGPSPYGMSTLHYTSYDPLFYVHH
SNTDRIWAIWQALQKYRGLPYNSANCEINKLKKPMMPFSSEDNPNEVTKAHSTGYKSFDY
QQLNYEYDNLNFHGMTIPQLEVHLKKIQEKDRVFAGFLLRAIGQSADVNFDVCRKDGECT
FGGTFCVLGGDYEMPWAFDRLFLYDISKSLVHLRLDAHDDFDIKVTIMGIDGKSLPPNLL
PSPTILFKPGTGKI
>6R833a:Hemocyanin subunit 1
NLLRKNVDTLTPDEILNLQVSLRAMQDDEGASGYQAISAYHGEPADCKAADGSTIVCCLH
GMPTFPMWHRLYLVQFEQALVAHGSTLGIPYWDWTKPMTQLPELVQHPLFIDPTGKKAKK
NVFYSGEIKFENKVTARAVDARLYQASQEGQKNFLLEGVLNALEQEDFCHFEVQLEVAHN
PIHYLVGGRFTHSMSSLEYTSYDPLFFLHHSNVERHFALWQALQKHRGLPTRPNCGLNLF
HSPMEPFGRDTNPFAITKDNSKASSLFDYEHLGYAFDDLSLNGMTIEELEALLKQRRSGA
RAFANFRLGGIKTSANVRIKLCIPTEDKRQSDNCDNDAGQFFILGGTNEMPWNFAFPYLH
EITDTVLSLGLALDSNYYVTAEVTAINGTLMPTQTIPRPIVTYIPPQGFKDVNMVNMDTS
SLRFRKDISSLTTEEEYELRVAMERFMSDKSINGYQALAEFHGLPAKCPRPDALNRVACC
IHGMATFPHWHRLVVMQFENALFTRGSPIGVPYWDWTKPFTALPSLLADETYVDPYTKET
KPNPFFKAPIEFLKAGVHTSRQIDERLFKQPSKGDHGFLYDGLSLAFEQDDFCDFEVQFE
VTHNSIHAWTGGSEPYSMSSLHYTSFDPMFWLHHSQVDRLWAIWQALQIQRGKPYKTYCA
NSEVYRPMKPFAFKSPLNNDEKTREHSVPTDVYDYQAELAYTYDTLFFGGLSIRELQRYV
EEAKSKDRVFAGFLLMGIQTSANVDLFVVAGGNEFFVGSIAVLGGSKEMTWRFDRVYKHE
ITDALGALGVDMFAEYTLRVDIKDVNGTALPPTAIPPPIVIFVPGIADANVKFDEQHRSR
KNVDSMTVSEMNALRTAMAAFAADKEVTGYQQVAAFHGSTQWCPSPDAAQKYACCHHGMA
TFPHWHRLIALNFENGLRRNGWSGGLPYWDWTRPIDALPALVLEAEYTDANGEAKPNPFF
SGAIDSIGASTSRAPTEALYEKPDFGKYTHLANEIISALEQEDFCDFEVQYEIAHNHIHA
LVGGTEAVSMASLEYSAFDPIFMLHHSNVDRIWATWQALQKFRGKAYNSANCAIEILRKP
MSPFSLASDINPDAMTREYSVPFDVFNYKKNFHYEYDTLELNGLSIXQLSREINRRKAKN
RVXVTFMLEGLKKSLLVEYFIAADGTDQKMKAGEFYVLGSENEMPWKFDRPYKSDITYVM
DAMKLHYTDKYHVELRITDMTGAEVTDLKLVTSVIYEPGIGNFGEGRRWISPITSASRIR
KNLLDFEDGEMESLRNAFKQMADEGRYEEIASFHGVPAQCPSEDGTMVHTCCLHGMPVFP
HWHRLYVSLVEDELLARGSGVAVPYWDWVEPFDELPRLINEATFYNSRTLQIEPNPFFKG
KISFENAETDRDTQPELFGNRYLYDHTLFVFEQTDFCEFEVHYEVLHNTIHSWLGGRDVH
SMSSLDYAAYDPVFFLHHSNVDRLWAIWQELQRYRKLSYNEANCALPLMNQPMRPFSNST
ANNDRLTFTNSRPNDVFDYQNVLHYKYDTLNFAGLSIPQLERILQKNQGRDRIFAGFLLH
GIKASADVRIYICVPTGIGEENCGNYAGIFSVLGGETEMPWQFDRLFRYEITDELKKLGL
NQNSHFRVEMELTAVNGSKITQKIFPNPTIIFVPSDVEFEEDTWRDVVTSANRIRRNLKD
LSKEDMFSLRAAFKRMTDDGRYEEIAAFHGLPAQCPNADGSNIHTCCLHGMPTFPHWHRL
YLSLVENELLARGSDVAVPYWDWIEPFDSLPGLISDETYKHPKTNEDIENPFHHGKISFA
DAVTVRKPRDQLFNNRYLYEHALFAFEHTDFCDFEVHFEVLHNSIHSWIGGPNPHSMSSL
DFAAYDPIFFLHHSTVDRLWAIWQDLQRYRKLDYNVANCALNLLNDPMRPFNNKTANQDH
LTFTNSRPNDVFDYQNSLNYKFDSLSFSGLSIPRLDDLLESRQSHDRVFAGFWLSGIKAS
ADVNIHICVPIGVEHEDCDNYAGTFAVLGGETEMPWAFDRLFRYEISDEMKKLQLTEDSK
FRLTTNIIASNGSKVSNDIFPTPTVIFVPKKERTEQVSTTKSVRGNLVRKNVDRLSLQEI
NSLIHALKRMQKDRSSDGFETIASFHALPPLCPNPTAKHRHACCLHGMATFPQWHRLYVV
QFEHSLNRHGAIVGVPYWDWTYPMTEVPGLLTSEKYTDPFTGIETFNPFNHGHISFISPE
TMTTREVSEHLFEQPALGKQTWLFNNIILALEQTDYCDFEVQFEIVHNSIHSWLGGKELY
SLNHLHYAAYDPAFFLHHSNVDRLWVVWQELQKFRGLPAYESNCAIELMSQPLKPFSFGA
PYNLNPVTTKYSKPSDVFNYKQNFHYEYDMLEMNGMSIAQLESYIRQERQKDRVFAGFLL
EGFGSSAYATFQVCPDVGDCYEGSHFSVLGGSTEMPWAFDRLYKMEITDILQAMDLKFDS
HFTIKTKIVAHNGTELPESLLPEATIVRIPPSAQNLEVAIPLNRIRRNINSLESRDVQNL
MSALKRLKEDESDFGFQTIAGYHGSLMCPTPEAPEYACCLHGMPTFMHWHRVYLLHFEES
MRRHGASVAVPYWDWTMPSDNLPSLLGDADYYDAWTDSVIENPFLRGHIKYEDTYTVREI
QPELFALAEGQKESTLFKDVMLMFEQEDYCDFEVQAEVIHNSIHYLIGGHQKYAMSSLMF
SSFDPIFYVHHSMVDRLWAIWQELQKHRKLPHDKAYCALDQMAFPMKPFIWESNPNPTTR
AVSTPSKLFDYKSLGYDYDHLNFHGMSIGQLEALIQKQKKADRVFAGFLLHGIKISADVH
LKICIEADCQEAGVIFVLGGETEMPWHFDRNYKMDITDVLKKRNIPPEALFEHDSKIRLE
VEIKSVDGAVLDPNSLPKPSLIYAPAKGLIIQQVGEYDAGSMVRKNVNSLTPSEIENLRN
ALAAVQADKTDAGYQKIASFHGMPLSCQYPDGTAFACCQHGMVTFPHWHRLYMKQMEDAL
KAKGAKIGIPYWDWTTAFHSLPILVTEPKNNPFHHGYIDVADTKTTRDPRPQLFDDPEQG
DQSFFYRQIAFALEQRDFCDFEIQFEMGHNAIHSWVGGPSPYGMSTLHYTSYDPLFYVHH
SNTDRIWAIWQALQKYRGLPYNSANCEINKLKKPMMPFSSEDNPNEVTKAHSTGYKSFDY
QQLNYEYDNLNFHGMTIPQLEVHLKKIQEKDRVFAGFLLRAIGQSADVNFDVCRKDGECT
FGGTFCVLGGDYEMPWAFDRLFLYDISKSLVHLRLDAHDDFDIKVTIMGIDGKSLPPNLL
PSPTILFKPGTGKI
>6R834a:Hemocyanin subunit 1
NLLRKNVDTLTPDEILNLQVSLRAMQDDEGASGYQAISAYHGEPADCKAADGSTIVCCLH
GMPTFPMWHRLYLVQFEQALVAHGSTLGIPYWDWTKPMTQLPELVQHPLFIDPTGKKAKK
NVFYSGEIKFENKVTARAVDARLYQASQEGQKNFLLEGVLNALEQEDFCHFEVQLEVAHN
PIHYLVGGRFTHSMSSLEYTSYDPLFFLHHSNVERHFALWQALQKHRGLPTRPNCGLNLF
HSPMEPFGRDTNPFAITKDNSKASSLFDYEHLGYAFDDLSLNGMTIEELEALLKQRRSGA
RAFANFRLGGIKTSANVRIKLCIPTEDKRQSDNCDNDAGQFFILGGTNEMPWNFAFPYLH
EITDTVLSLGLALDSNYYVTAEVTAINGTLMPTQTIPRPIVTYIPPQGFKDVNMVNMDTS
SLRFRKDISSLTTEEEYELRVAMERFMSDKSINGYQALAEFHGLPAKCPRPDALNRVACC
IHGMATFPHWHRLVVMQFENALFTRGSPIGVPYWDWTKPFTALPSLLADETYVDPYTKET
KPNPFFKAPIEFLKAGVHTSRQIDERLFKQPSKGDHGFLYDGLSLAFEQDDFCDFEVQFE
VTHNSIHAWTGGSEPYSMSSLHYTSFDPMFWLHHSQVDRLWAIWQALQIQRGKPYKTYCA
NSEVYRPMKPFAFKSPLNNDEKTREHSVPTDVYDYQAELAYTYDTLFFGGLSIRELQRYV
EEAKSKDRVFAGFLLMGIQTSANVDLFVVAGGNEFFVGSIAVLGGSKEMTWRFDRVYKHE
ITDALGALGVDMFAEYTLRVDIKDVNGTALPPTAIPPPIVIFVPGIADANVKFDEQHRSR
KNVDSMTVSEMNALRTAMAAFAADKEVTGYQQVAAFHGSTQWCPSPDAAQKYACCHHGMA
TFPHWHRLIALNFENGLRRNGWSGGLPYWDWTRPIDALPALVLEAEYTDANGEAKPNPFF
SGAIDSIGASTSRAPTEALYEKPDFGKYTHLANEIISALEQEDFCDFEVQYEIAHNHIHA
LVGGTEAVSMASLEYSAFDPIFMLHHSNVDRIWATWQALQKFRGKAYNSANCAIEILRKP
MSPFSLASDINPDAMTREYSVPFDVFNYKKNFHYEYDTLELNGLSIXQLSREINRRKAKN
RVXVTFMLEGLKKSLLVEYFIAADGTDQKMKAGEFYVLGSENEMPWKFDRPYKSDITYVM
DAMKLHYTDKYHVELRITDMTGAEVTDLKLVTSVIYEPGIGNFGEGRRWISPITSASRIR
KNLLDFEDGEMESLRNAFKQMADEGRYEEIASFHGVPAQCPSEDGTMVHTCCLHGMPVFP
HWHRLYVSLVEDELLARGSGVAVPYWDWVEPFDELPRLINEATFYNSRTLQIEPNPFFKG
KISFENAETDRDTQPELFGNRYLYDHTLFVFEQTDFCEFEVHYEVLHNTIHSWLGGRDVH
SMSSLDYAAYDPVFFLHHSNVDRLWAIWQELQRYRKLSYNEANCALPLMNQPMRPFSNST
ANNDRLTFTNSRPNDVFDYQNVLHYKYDTLNFAGLSIPQLERILQKNQGRDRIFAGFLLH
GIKASADVRIYICVPTGIGEENCGNYAGIFSVLGGETEMPWQFDRLFRYEITDELKKLGL
NQNSHFRVEMELTAVNGSKITQKIFPNPTIIFVPSDVEFEEDTWRDVVTSANRIRRNLKD
LSKEDMFSLRAAFKRMTDDGRYEEIAAFHGLPAQCPNADGSNIHTCCLHGMPTFPHWHRL
YLSLVENELLARGSDVAVPYWDWIEPFDSLPGLISDETYKHPKTNEDIENPFHHGKISFA
DAVTVRKPRDQLFNNRYLYEHALFAFEHTDFCDFEVHFEVLHNSIHSWIGGPNPHSMSSL
DFAAYDPIFFLHHSTVDRLWAIWQDLQRYRKLDYNVANCALNLLNDPMRPFNNKTANQDH
LTFTNSRPNDVFDYQNSLNYKFDSLSFSGLSIPRLDDLLESRQSHDRVFAGFWLSGIKAS
ADVNIHICVPIGVEHEDCDNYAGTFAVLGGETEMPWAFDRLFRYEISDEMKKLQLTEDSK
FRLTTNIIASNGSKVSNDIFPTPTVIFVPKKERTEQVSTTKSVRGNLVRKNVDRLSLQEI
NSLIHALKRMQKDRSSDGFETIASFHALPPLCPNPTAKHRHACCLHGMATFPQWHRLYVV
QFEHSLNRHGAIVGVPYWDWTYPMTEVPGLLTSEKYTDPFTGIETFNPFNHGHISFISPE
TMTTREVSEHLFEQPALGKQTWLFNNIILALEQTDYCDFEVQFEIVHNSIHSWLGGKELY
SLNHLHYAAYDPAFFLHHSNVDRLWVVWQELQKFRGLPAYESNCAIELMSQPLKPFSFGA
PYNLNPVTTKYSKPSDVFNYKQNFHYEYDMLEMNGMSIAQLESYIRQERQKDRVFAGFLL
EGFGSSAYATFQVCPDVGDCYEGSHFSVLGGSTEMPWAFDRLYKMEITDILQAMDLKFDS
HFTIKTKIVAHNGTELPESLLPEATIVRIPPSAQNLEVAIPLNRIRRNINSLESRDVQNL
MSALKRLKEDESDFGFQTIAGYHGSLMCPTPEAPEYACCLHGMPTFMHWHRVYLLHFEES
MRRHGASVAVPYWDWTMPSDNLPSLLGDADYYDAWTDSVIENPFLRGHIKYEDTYTVREI
QPELFALAEGQKESTLFKDVMLMFEQEDYCDFEVQAEVIHNSIHYLIGGHQKYAMSSLMF
SSFDPIFYVHHSMVDRLWAIWQELQKHRKLPHDKAYCALDQMAFPMKPFIWESNPNPTTR
AVSTPSKLFDYKSLGYDYDHLNFHGMSIGQLEALIQKQKKADRVFAGFLLHGIKISADVH
LKICIEADCQEAGVIFVLGGETEMPWHFDRNYKMDITDVLKKRNIPPEALFEHDSKIRLE
VEIKSVDGAVLDPNSLPKPSLIYAPAKGLIIQQVGEYDAGSMVRKNVNSLTPSEIENLRN
ALAAVQADKTDAGYQKIASFHGMPLSCQYPDGTAFACCQHGMVTFPHWHRLYMKQMEDAL
KAKGAKIGIPYWDWTTAFHSLPILVTEPKNNPFHHGYIDVADTKTTRDPRPQLFDDPEQG
DQSFFYRQIAFALEQRDFCDFEIQFEMGHNAIHSWVGGPSPYGMSTLHYTSYDPLFYVHH
SNTDRIWAIWQALQKYRGLPYNSANCEINKLKKPMMPFSSEDNPNEVTKAHSTGYKSFDY
QQLNYEYDNLNFHGMTIPQLEVHLKKIQEKDRVFAGFLLRAIGQSADVNFDVCRKDGECT
FGGTFCVLGGDYEMPWAFDRLFLYDISKSLVHLRLDAHDDFDIKVTIMGIDGKSLPPNLL
PSPTILFKPGTGKI
>6R835a:Hemocyanin subunit 1
NLLRKNVDTLTPDEILNLQVSLRAMQDDEGASGYQAISAYHGEPADCKAADGSTIVCCLH
GMPTFPMWHRLYLVQFEQALVAHGSTLGIPYWDWTKPMTQLPELVQHPLFIDPTGKKAKK
NVFYSGEIKFENKVTARAVDARLYQASQEGQKNFLLEGVLNALEQEDFCHFEVQLEVAHN
PIHYLVGGRFTHSMSSLEYTSYDPLFFLHHSNVERHFALWQALQKHRGLPTRPNCGLNLF
HSPMEPFGRDTNPFAITKDNSKASSLFDYEHLGYAFDDLSLNGMTIEELEALLKQRRSGA
RAFANFRLGGIKTSANVRIKLCIPTEDKRQSDNCDNDAGQFFILGGTNEMPWNFAFPYLH
EITDTVLSLGLALDSNYYVTAEVTAINGTLMPTQTIPRPIVTYIPPQGFKDVNMVNMDTS
SLRFRKDISSLTTEEEYELRVAMERFMSDKSINGYQALAEFHGLPAKCPRPDALNRVACC
IHGMATFPHWHRLVVMQFENALFTRGSPIGVPYWDWTKPFTALPSLLADETYVDPYTKET
KPNPFFKAPIEFLKAGVHTSRQIDERLFKQPSKGDHGFLYDGLSLAFEQDDFCDFEVQFE
VTHNSIHAWTGGSEPYSMSSLHYTSFDPMFWLHHSQVDRLWAIWQALQIQRGKPYKTYCA
NSEVYRPMKPFAFKSPLNNDEKTREHSVPTDVYDYQAELAYTYDTLFFGGLSIRELQRYV
EEAKSKDRVFAGFLLMGIQTSANVDLFVVAGGNEFFVGSIAVLGGSKEMTWRFDRVYKHE
ITDALGALGVDMFAEYTLRVDIKDVNGTALPPTAIPPPIVIFVPGIADANVKFDEQHRSR
KNVDSMTVSEMNALRTAMAAFAADKEVTGYQQVAAFHGSTQWCPSPDAAQKYACCHHGMA
TFPHWHRLIALNFENGLRRNGWSGGLPYWDWTRPIDALPALVLEAEYTDANGEAKPNPFF
SGAIDSIGASTSRAPTEALYEKPDFGKYTHLANEIISALEQEDFCDFEVQYEIAHNHIHA
LVGGTEAVSMASLEYSAFDPIFMLHHSNVDRIWATWQALQKFRGKAYNSANCAIEILRKP
MSPFSLASDINPDAMTREYSVPFDVFNYKKNFHYEYDTLELNGLSIXQLSREINRRKAKN
RVXVTFMLEGLKKSLLVEYFIAADGTDQKMKAGEFYVLGSENEMPWKFDRPYKSDITYVM
DAMKLHYTDKYHVELRITDMTGAEVTDLKLVTSVIYEPGIGNFGEGRRWISPITSASRIR
KNLLDFEDGEMESLRNAFKQMADEGRYEEIASFHGVPAQCPSEDGTMVHTCCLHGMPVFP
HWHRLYVSLVEDELLARGSGVAVPYWDWVEPFDELPRLINEATFYNSRTLQIEPNPFFKG
KISFENAETDRDTQPELFGNRYLYDHTLFVFEQTDFCEFEVHYEVLHNTIHSWLGGRDVH
SMSSLDYAAYDPVFFLHHSNVDRLWAIWQELQRYRKLSYNEANCALPLMNQPMRPFSNST
ANNDRLTFTNSRPNDVFDYQNVLHYKYDTLNFAGLSIPQLERILQKNQGRDRIFAGFLLH
GIKASADVRIYICVPTGIGEENCGNYAGIFSVLGGETEMPWQFDRLFRYEITDELKKLGL
NQNSHFRVEMELTAVNGSKITQKIFPNPTIIFVPSDVEFEEDTWRDVVTSANRIRRNLKD
LSKEDMFSLRAAFKRMTDDGRYEEIAAFHGLPAQCPNADGSNIHTCCLHGMPTFPHWHRL
YLSLVENELLARGSDVAVPYWDWIEPFDSLPGLISDETYKHPKTNEDIENPFHHGKISFA
DAVTVRKPRDQLFNNRYLYEHALFAFEHTDFCDFEVHFEVLHNSIHSWIGGPNPHSMSSL
DFAAYDPIFFLHHSTVDRLWAIWQDLQRYRKLDYNVANCALNLLNDPMRPFNNKTANQDH
LTFTNSRPNDVFDYQNSLNYKFDSLSFSGLSIPRLDDLLESRQSHDRVFAGFWLSGIKAS
ADVNIHICVPIGVEHEDCDNYAGTFAVLGGETEMPWAFDRLFRYEISDEMKKLQLTEDSK
FRLTTNIIASNGSKVSNDIFPTPTVIFVPKKERTEQVSTTKSVRGNLVRKNVDRLSLQEI
NSLIHALKRMQKDRSSDGFETIASFHALPPLCPNPTAKHRHACCLHGMATFPQWHRLYVV
QFEHSLNRHGAIVGVPYWDWTYPMTEVPGLLTSEKYTDPFTGIETFNPFNHGHISFISPE
TMTTREVSEHLFEQPALGKQTWLFNNIILALEQTDYCDFEVQFEIVHNSIHSWLGGKELY
SLNHLHYAAYDPAFFLHHSNVDRLWVVWQELQKFRGLPAYESNCAIELMSQPLKPFSFGA
PYNLNPVTTKYSKPSDVFNYKQNFHYEYDMLEMNGMSIAQLESYIRQERQKDRVFAGFLL
EGFGSSAYATFQVCPDVGDCYEGSHFSVLGGSTEMPWAFDRLYKMEITDILQAMDLKFDS
HFTIKTKIVAHNGTELPESLLPEATIVRIPPSAQNLEVAIPLNRIRRNINSLESRDVQNL
MSALKRLKEDESDFGFQTIAGYHGSLMCPTPEAPEYACCLHGMPTFMHWHRVYLLHFEES
MRRHGASVAVPYWDWTMPSDNLPSLLGDADYYDAWTDSVIENPFLRGHIKYEDTYTVREI
QPELFALAEGQKESTLFKDVMLMFEQEDYCDFEVQAEVIHNSIHYLIGGHQKYAMSSLMF
SSFDPIFYVHHSMVDRLWAIWQELQKHRKLPHDKAYCALDQMAFPMKPFIWESNPNPTTR
AVSTPSKLFDYKSLGYDYDHLNFHGMSIGQLEALIQKQKKADRVFAGFLLHGIKISADVH
LKICIEADCQEAGVIFVLGGETEMPWHFDRNYKMDITDVLKKRNIPPEALFEHDSKIRLE
VEIKSVDGAVLDPNSLPKPSLIYAPAKGLIIQQVGEYDAGSMVRKNVNSLTPSEIENLRN
ALAAVQADKTDAGYQKIASFHGMPLSCQYPDGTAFACCQHGMVTFPHWHRLYMKQMEDAL
KAKGAKIGIPYWDWTTAFHSLPILVTEPKNNPFHHGYIDVADTKTTRDPRPQLFDDPEQG
DQSFFYRQIAFALEQRDFCDFEIQFEMGHNAIHSWVGGPSPYGMSTLHYTSYDPLFYVHH
SNTDRIWAIWQALQKYRGLPYNSANCEINKLKKPMMPFSSEDNPNEVTKAHSTGYKSFDY
QQLNYEYDNLNFHGMTIPQLEVHLKKIQEKDRVFAGFLLRAIGQSADVNFDVCRKDGECT
FGGTFCVLGGDYEMPWAFDRLFLYDISKSLVHLRLDAHDDFDIKVTIMGIDGKSLPPNLL
PSPTILFKPGTGKI
>6R836a:Hemocyanin subunit 1
NLLRKNVDTLTPDEILNLQVSLRAMQDDEGASGYQAISAYHGEPADCKAADGSTIVCCLH
GMPTFPMWHRLYLVQFEQALVAHGSTLGIPYWDWTKPMTQLPELVQHPLFIDPTGKKAKK
NVFYSGEIKFENKVTARAVDARLYQASQEGQKNFLLEGVLNALEQEDFCHFEVQLEVAHN
PIHYLVGGRFTHSMSSLEYTSYDPLFFLHHSNVERHFALWQALQKHRGLPTRPNCGLNLF
HSPMEPFGRDTNPFAITKDNSKASSLFDYEHLGYAFDDLSLNGMTIEELEALLKQRRSGA
RAFANFRLGGIKTSANVRIKLCIPTEDKRQSDNCDNDAGQFFILGGTNEMPWNFAFPYLH
EITDTVLSLGLALDSNYYVTAEVTAINGTLMPTQTIPRPIVTYIPPQGFKDVNMVNMDTS
SLRFRKDISSLTTEEEYELRVAMERFMSDKSINGYQALAEFHGLPAKCPRPDALNRVACC
IHGMATFPHWHRLVVMQFENALFTRGSPIGVPYWDWTKPFTALPSLLADETYVDPYTKET
KPNPFFKAPIEFLKAGVHTSRQIDERLFKQPSKGDHGFLYDGLSLAFEQDDFCDFEVQFE
VTHNSIHAWTGGSEPYSMSSLHYTSFDPMFWLHHSQVDRLWAIWQALQIQRGKPYKTYCA
NSEVYRPMKPFAFKSPLNNDEKTREHSVPTDVYDYQAELAYTYDTLFFGGLSIRELQRYV
EEAKSKDRVFAGFLLMGIQTSANVDLFVVAGGNEFFVGSIAVLGGSKEMTWRFDRVYKHE
ITDALGALGVDMFAEYTLRVDIKDVNGTALPPTAIPPPIVIFVPGIADANVKFDEQHRSR
KNVDSMTVSEMNALRTAMAAFAADKEVTGYQQVAAFHGSTQWCPSPDAAQKYACCHHGMA
TFPHWHRLIALNFENGLRRNGWSGGLPYWDWTRPIDALPALVLEAEYTDANGEAKPNPFF
SGAIDSIGASTSRAPTEALYEKPDFGKYTHLANEIISALEQEDFCDFEVQYEIAHNHIHA
LVGGTEAVSMASLEYSAFDPIFMLHHSNVDRIWATWQALQKFRGKAYNSANCAIEILRKP
MSPFSLASDINPDAMTREYSVPFDVFNYKKNFHYEYDTLELNGLSIXQLSREINRRKAKN
RVXVTFMLEGLKKSLLVEYFIAADGTDQKMKAGEFYVLGSENEMPWKFDRPYKSDITYVM
DAMKLHYTDKYHVELRITDMTGAEVTDLKLVTSVIYEPGIGNFGEGRRWISPITSASRIR
KNLLDFEDGEMESLRNAFKQMADEGRYEEIASFHGVPAQCPSEDGTMVHTCCLHGMPVFP
HWHRLYVSLVEDELLARGSGVAVPYWDWVEPFDELPRLINEATFYNSRTLQIEPNPFFKG
KISFENAETDRDTQPELFGNRYLYDHTLFVFEQTDFCEFEVHYEVLHNTIHSWLGGRDVH
SMSSLDYAAYDPVFFLHHSNVDRLWAIWQELQRYRKLSYNEANCALPLMNQPMRPFSNST
ANNDRLTFTNSRPNDVFDYQNVLHYKYDTLNFAGLSIPQLERILQKNQGRDRIFAGFLLH
GIKASADVRIYICVPTGIGEENCGNYAGIFSVLGGETEMPWQFDRLFRYEITDELKKLGL
NQNSHFRVEMELTAVNGSKITQKIFPNPTIIFVPSDVEFEEDTWRDVVTSANRIRRNLKD
LSKEDMFSLRAAFKRMTDDGRYEEIAAFHGLPAQCPNADGSNIHTCCLHGMPTFPHWHRL
YLSLVENELLARGSDVAVPYWDWIEPFDSLPGLISDETYKHPKTNEDIENPFHHGKISFA
DAVTVRKPRDQLFNNRYLYEHALFAFEHTDFCDFEVHFEVLHNSIHSWIGGPNPHSMSSL
DFAAYDPIFFLHHSTVDRLWAIWQDLQRYRKLDYNVANCALNLLNDPMRPFNNKTANQDH
LTFTNSRPNDVFDYQNSLNYKFDSLSFSGLSIPRLDDLLESRQSHDRVFAGFWLSGIKAS
ADVNIHICVPIGVEHEDCDNYAGTFAVLGGETEMPWAFDRLFRYEISDEMKKLQLTEDSK
FRLTTNIIASNGSKVSNDIFPTPTVIFVPKKERTEQVSTTKSVRGNLVRKNVDRLSLQEI
NSLIHALKRMQKDRSSDGFETIASFHALPPLCPNPTAKHRHACCLHGMATFPQWHRLYVV
QFEHSLNRHGAIVGVPYWDWTYPMTEVPGLLTSEKYTDPFTGIETFNPFNHGHISFISPE
TMTTREVSEHLFEQPALGKQTWLFNNIILALEQTDYCDFEVQFEIVHNSIHSWLGGKELY
SLNHLHYAAYDPAFFLHHSNVDRLWVVWQELQKFRGLPAYESNCAIELMSQPLKPFSFGA
PYNLNPVTTKYSKPSDVFNYKQNFHYEYDMLEMNGMSIAQLESYIRQERQKDRVFAGFLL
EGFGSSAYATFQVCPDVGDCYEGSHFSVLGGSTEMPWAFDRLYKMEITDILQAMDLKFDS
HFTIKTKIVAHNGTELPESLLPEATIVRIPPSAQNLEVAIPLNRIRRNINSLESRDVQNL
MSALKRLKEDESDFGFQTIAGYHGSLMCPTPEAPEYACCLHGMPTFMHWHRVYLLHFEES
MRRHGASVAVPYWDWTMPSDNLPSLLGDADYYDAWTDSVIENPFLRGHIKYEDTYTVREI
QPELFALAEGQKESTLFKDVMLMFEQEDYCDFEVQAEVIHNSIHYLIGGHQKYAMSSLMF
SSFDPIFYVHHSMVDRLWAIWQELQKHRKLPHDKAYCALDQMAFPMKPFIWESNPNPTTR
AVSTPSKLFDYKSLGYDYDHLNFHGMSIGQLEALIQKQKKADRVFAGFLLHGIKISADVH
LKICIEADCQEAGVIFVLGGETEMPWHFDRNYKMDITDVLKKRNIPPEALFEHDSKIRLE
VEIKSVDGAVLDPNSLPKPSLIYAPAKGLIIQQVGEYDAGSMVRKNVNSLTPSEIENLRN
ALAAVQADKTDAGYQKIASFHGMPLSCQYPDGTAFACCQHGMVTFPHWHRLYMKQMEDAL
KAKGAKIGIPYWDWTTAFHSLPILVTEPKNNPFHHGYIDVADTKTTRDPRPQLFDDPEQG
DQSFFYRQIAFALEQRDFCDFEIQFEMGHNAIHSWVGGPSPYGMSTLHYTSYDPLFYVHH
SNTDRIWAIWQALQKYRGLPYNSANCEINKLKKPMMPFSSEDNPNEVTKAHSTGYKSFDY
QQLNYEYDNLNFHGMTIPQLEVHLKKIQEKDRVFAGFLLRAIGQSADVNFDVCRKDGECT
FGGTFCVLGGDYEMPWAFDRLFLYDISKSLVHLRLDAHDDFDIKVTIMGIDGKSLPPNLL
PSPTILFKPGTGKI
>6R837a:Hemocyanin subunit 1
NLLRKNVDTLTPDEILNLQVSLRAMQDDEGASGYQAISAYHGEPADCKAADGSTIVCCLH
GMPTFPMWHRLYLVQFEQALVAHGSTLGIPYWDWTKPMTQLPELVQHPLFIDPTGKKAKK
NVFYSGEIKFENKVTARAVDARLYQASQEGQKNFLLEGVLNALEQEDFCHFEVQLEVAHN
PIHYLVGGRFTHSMSSLEYTSYDPLFFLHHSNVERHFALWQALQKHRGLPTRPNCGLNLF
HSPMEPFGRDTNPFAITKDNSKASSLFDYEHLGYAFDDLSLNGMTIEELEALLKQRRSGA
RAFANFRLGGIKTSANVRIKLCIPTEDKRQSDNCDNDAGQFFILGGTNEMPWNFAFPYLH
EITDTVLSLGLALDSNYYVTAEVTAINGTLMPTQTIPRPIVTYIPPQGFKDVNMVNMDTS
SLRFRKDISSLTTEEEYELRVAMERFMSDKSINGYQALAEFHGLPAKCPRPDALNRVACC
IHGMATFPHWHRLVVMQFENALFTRGSPIGVPYWDWTKPFTALPSLLADETYVDPYTKET
KPNPFFKAPIEFLKAGVHTSRQIDERLFKQPSKGDHGFLYDGLSLAFEQDDFCDFEVQFE
VTHNSIHAWTGGSEPYSMSSLHYTSFDPMFWLHHSQVDRLWAIWQALQIQRGKPYKTYCA
NSEVYRPMKPFAFKSPLNNDEKTREHSVPTDVYDYQAELAYTYDTLFFGGLSIRELQRYV
EEAKSKDRVFAGFLLMGIQTSANVDLFVVAGGNEFFVGSIAVLGGSKEMTWRFDRVYKHE
ITDALGALGVDMFAEYTLRVDIKDVNGTALPPTAIPPPIVIFVPGIADANVKFDEQHRSR
KNVDSMTVSEMNALRTAMAAFAADKEVTGYQQVAAFHGSTQWCPSPDAAQKYACCHHGMA
TFPHWHRLIALNFENGLRRNGWSGGLPYWDWTRPIDALPALVLEAEYTDANGEAKPNPFF
SGAIDSIGASTSRAPTEALYEKPDFGKYTHLANEIISALEQEDFCDFEVQYEIAHNHIHA
LVGGTEAVSMASLEYSAFDPIFMLHHSNVDRIWATWQALQKFRGKAYNSANCAIEILRKP
MSPFSLASDINPDAMTREYSVPFDVFNYKKNFHYEYDTLELNGLSIXQLSREINRRKAKN
RVXVTFMLEGLKKSLLVEYFIAADGTDQKMKAGEFYVLGSENEMPWKFDRPYKSDITYVM
DAMKLHYTDKYHVELRITDMTGAEVTDLKLVTSVIYEPGIGNFGEGRRWISPITSASRIR
KNLLDFEDGEMESLRNAFKQMADEGRYEEIASFHGVPAQCPSEDGTMVHTCCLHGMPVFP
HWHRLYVSLVEDELLARGSGVAVPYWDWVEPFDELPRLINEATFYNSRTLQIEPNPFFKG
KISFENAETDRDTQPELFGNRYLYDHTLFVFEQTDFCEFEVHYEVLHNTIHSWLGGRDVH
SMSSLDYAAYDPVFFLHHSNVDRLWAIWQELQRYRKLSYNEANCALPLMNQPMRPFSNST
ANNDRLTFTNSRPNDVFDYQNVLHYKYDTLNFAGLSIPQLERILQKNQGRDRIFAGFLLH
GIKASADVRIYICVPTGIGEENCGNYAGIFSVLGGETEMPWQFDRLFRYEITDELKKLGL
NQNSHFRVEMELTAVNGSKITQKIFPNPTIIFVPSDVEFEEDTWRDVVTSANRIRRNLKD
LSKEDMFSLRAAFKRMTDDGRYEEIAAFHGLPAQCPNADGSNIHTCCLHGMPTFPHWHRL
YLSLVENELLARGSDVAVPYWDWIEPFDSLPGLISDETYKHPKTNEDIENPFHHGKISFA
DAVTVRKPRDQLFNNRYLYEHALFAFEHTDFCDFEVHFEVLHNSIHSWIGGPNPHSMSSL
DFAAYDPIFFLHHSTVDRLWAIWQDLQRYRKLDYNVANCALNLLNDPMRPFNNKTANQDH
LTFTNSRPNDVFDYQNSLNYKFDSLSFSGLSIPRLDDLLESRQSHDRVFAGFWLSGIKAS
ADVNIHICVPIGVEHEDCDNYAGTFAVLGGETEMPWAFDRLFRYEISDEMKKLQLTEDSK
FRLTTNIIASNGSKVSNDIFPTPTVIFVPKKERTEQVSTTKSVRGNLVRKNVDRLSLQEI
NSLIHALKRMQKDRSSDGFETIASFHALPPLCPNPTAKHRHACCLHGMATFPQWHRLYVV
QFEHSLNRHGAIVGVPYWDWTYPMTEVPGLLTSEKYTDPFTGIETFNPFNHGHISFISPE
TMTTREVSEHLFEQPALGKQTWLFNNIILALEQTDYCDFEVQFEIVHNSIHSWLGGKELY
SLNHLHYAAYDPAFFLHHSNVDRLWVVWQELQKFRGLPAYESNCAIELMSQPLKPFSFGA
PYNLNPVTTKYSKPSDVFNYKQNFHYEYDMLEMNGMSIAQLESYIRQERQKDRVFAGFLL
EGFGSSAYATFQVCPDVGDCYEGSHFSVLGGSTEMPWAFDRLYKMEITDILQAMDLKFDS
HFTIKTKIVAHNGTELPESLLPEATIVRIPPSAQNLEVAIPLNRIRRNINSLESRDVQNL
MSALKRLKEDESDFGFQTIAGYHGSLMCPTPEAPEYACCLHGMPTFMHWHRVYLLHFEES
MRRHGASVAVPYWDWTMPSDNLPSLLGDADYYDAWTDSVIENPFLRGHIKYEDTYTVREI
QPELFALAEGQKESTLFKDVMLMFEQEDYCDFEVQAEVIHNSIHYLIGGHQKYAMSSLMF
SSFDPIFYVHHSMVDRLWAIWQELQKHRKLPHDKAYCALDQMAFPMKPFIWESNPNPTTR
AVSTPSKLFDYKSLGYDYDHLNFHGMSIGQLEALIQKQKKADRVFAGFLLHGIKISADVH
LKICIEADCQEAGVIFVLGGETEMPWHFDRNYKMDITDVLKKRNIPPEALFEHDSKIRLE
VEIKSVDGAVLDPNSLPKPSLIYAPAKGLIIQQVGEYDAGSMVRKNVNSLTPSEIENLRN
ALAAVQADKTDAGYQKIASFHGMPLSCQYPDGTAFACCQHGMVTFPHWHRLYMKQMEDAL
KAKGAKIGIPYWDWTTAFHSLPILVTEPKNNPFHHGYIDVADTKTTRDPRPQLFDDPEQG
DQSFFYRQIAFALEQRDFCDFEIQFEMGHNAIHSWVGGPSPYGMSTLHYTSYDPLFYVHH
SNTDRIWAIWQALQKYRGLPYNSANCEINKLKKPMMPFSSEDNPNEVTKAHSTGYKSFDY
QQLNYEYDNLNFHGMTIPQLEVHLKKIQEKDRVFAGFLLRAIGQSADVNFDVCRKDGECT
FGGTFCVLGGDYEMPWAFDRLFLYDISKSLVHLRLDAHDDFDIKVTIMGIDGKSLPPNLL
PSPTILFKPGTGKI
>6R838a:Hemocyanin subunit 1
NLLRKNVDTLTPDEILNLQVSLRAMQDDEGASGYQAISAYHGEPADCKAADGSTIVCCLH
GMPTFPMWHRLYLVQFEQALVAHGSTLGIPYWDWTKPMTQLPELVQHPLFIDPTGKKAKK
NVFYSGEIKFENKVTARAVDARLYQASQEGQKNFLLEGVLNALEQEDFCHFEVQLEVAHN
PIHYLVGGRFTHSMSSLEYTSYDPLFFLHHSNVERHFALWQALQKHRGLPTRPNCGLNLF
HSPMEPFGRDTNPFAITKDNSKASSLFDYEHLGYAFDDLSLNGMTIEELEALLKQRRSGA
RAFANFRLGGIKTSANVRIKLCIPTEDKRQSDNCDNDAGQFFILGGTNEMPWNFAFPYLH
EITDTVLSLGLALDSNYYVTAEVTAINGTLMPTQTIPRPIVTYIPPQGFKDVNMVNMDTS
SLRFRKDISSLTTEEEYELRVAMERFMSDKSINGYQALAEFHGLPAKCPRPDALNRVACC
IHGMATFPHWHRLVVMQFENALFTRGSPIGVPYWDWTKPFTALPSLLADETYVDPYTKET
KPNPFFKAPIEFLKAGVHTSRQIDERLFKQPSKGDHGFLYDGLSLAFEQDDFCDFEVQFE
VTHNSIHAWTGGSEPYSMSSLHYTSFDPMFWLHHSQVDRLWAIWQALQIQRGKPYKTYCA
NSEVYRPMKPFAFKSPLNNDEKTREHSVPTDVYDYQAELAYTYDTLFFGGLSIRELQRYV
EEAKSKDRVFAGFLLMGIQTSANVDLFVVAGGNEFFVGSIAVLGGSKEMTWRFDRVYKHE
ITDALGALGVDMFAEYTLRVDIKDVNGTALPPTAIPPPIVIFVPGIADANVKFDEQHRSR
KNVDSMTVSEMNALRTAMAAFAADKEVTGYQQVAAFHGSTQWCPSPDAAQKYACCHHGMA
TFPHWHRLIALNFENGLRRNGWSGGLPYWDWTRPIDALPALVLEAEYTDANGEAKPNPFF
SGAIDSIGASTSRAPTEALYEKPDFGKYTHLANEIISALEQEDFCDFEVQYEIAHNHIHA
LVGGTEAVSMASLEYSAFDPIFMLHHSNVDRIWATWQALQKFRGKAYNSANCAIEILRKP
MSPFSLASDINPDAMTREYSVPFDVFNYKKNFHYEYDTLELNGLSIXQLSREINRRKAKN
RVXVTFMLEGLKKSLLVEYFIAADGTDQKMKAGEFYVLGSENEMPWKFDRPYKSDITYVM
DAMKLHYTDKYHVELRITDMTGAEVTDLKLVTSVIYEPGIGNFGEGRRWISPITSASRIR
KNLLDFEDGEMESLRNAFKQMADEGRYEEIASFHGVPAQCPSEDGTMVHTCCLHGMPVFP
HWHRLYVSLVEDELLARGSGVAVPYWDWVEPFDELPRLINEATFYNSRTLQIEPNPFFKG
KISFENAETDRDTQPELFGNRYLYDHTLFVFEQTDFCEFEVHYEVLHNTIHSWLGGRDVH
SMSSLDYAAYDPVFFLHHSNVDRLWAIWQELQRYRKLSYNEANCALPLMNQPMRPFSNST
ANNDRLTFTNSRPNDVFDYQNVLHYKYDTLNFAGLSIPQLERILQKNQGRDRIFAGFLLH
GIKASADVRIYICVPTGIGEENCGNYAGIFSVLGGETEMPWQFDRLFRYEITDELKKLGL
NQNSHFRVEMELTAVNGSKITQKIFPNPTIIFVPSDVEFEEDTWRDVVTSANRIRRNLKD
LSKEDMFSLRAAFKRMTDDGRYEEIAAFHGLPAQCPNADGSNIHTCCLHGMPTFPHWHRL
YLSLVENELLARGSDVAVPYWDWIEPFDSLPGLISDETYKHPKTNEDIENPFHHGKISFA
DAVTVRKPRDQLFNNRYLYEHALFAFEHTDFCDFEVHFEVLHNSIHSWIGGPNPHSMSSL
DFAAYDPIFFLHHSTVDRLWAIWQDLQRYRKLDYNVANCALNLLNDPMRPFNNKTANQDH
LTFTNSRPNDVFDYQNSLNYKFDSLSFSGLSIPRLDDLLESRQSHDRVFAGFWLSGIKAS
ADVNIHICVPIGVEHEDCDNYAGTFAVLGGETEMPWAFDRLFRYEISDEMKKLQLTEDSK
FRLTTNIIASNGSKVSNDIFPTPTVIFVPKKERTEQVSTTKSVRGNLVRKNVDRLSLQEI
NSLIHALKRMQKDRSSDGFETIASFHALPPLCPNPTAKHRHACCLHGMATFPQWHRLYVV
QFEHSLNRHGAIVGVPYWDWTYPMTEVPGLLTSEKYTDPFTGIETFNPFNHGHISFISPE
TMTTREVSEHLFEQPALGKQTWLFNNIILALEQTDYCDFEVQFEIVHNSIHSWLGGKELY
SLNHLHYAAYDPAFFLHHSNVDRLWVVWQELQKFRGLPAYESNCAIELMSQPLKPFSFGA
PYNLNPVTTKYSKPSDVFNYKQNFHYEYDMLEMNGMSIAQLESYIRQERQKDRVFAGFLL
EGFGSSAYATFQVCPDVGDCYEGSHFSVLGGSTEMPWAFDRLYKMEITDILQAMDLKFDS
HFTIKTKIVAHNGTELPESLLPEATIVRIPPSAQNLEVAIPLNRIRRNINSLESRDVQNL
MSALKRLKEDESDFGFQTIAGYHGSLMCPTPEAPEYACCLHGMPTFMHWHRVYLLHFEES
MRRHGASVAVPYWDWTMPSDNLPSLLGDADYYDAWTDSVIENPFLRGHIKYEDTYTVREI
QPELFALAEGQKESTLFKDVMLMFEQEDYCDFEVQAEVIHNSIHYLIGGHQKYAMSSLMF
SSFDPIFYVHHSMVDRLWAIWQELQKHRKLPHDKAYCALDQMAFPMKPFIWESNPNPTTR
AVSTPSKLFDYKSLGYDYDHLNFHGMSIGQLEALIQKQKKADRVFAGFLLHGIKISADVH
LKICIEADCQEAGVIFVLGGETEMPWHFDRNYKMDITDVLKKRNIPPEALFEHDSKIRLE
VEIKSVDGAVLDPNSLPKPSLIYAPAKGLIIQQVGEYDAGSMVRKNVNSLTPSEIENLRN
ALAAVQADKTDAGYQKIASFHGMPLSCQYPDGTAFACCQHGMVTFPHWHRLYMKQMEDAL
KAKGAKIGIPYWDWTTAFHSLPILVTEPKNNPFHHGYIDVADTKTTRDPRPQLFDDPEQG
DQSFFYRQIAFALEQRDFCDFEIQFEMGHNAIHSWVGGPSPYGMSTLHYTSYDPLFYVHH
SNTDRIWAIWQALQKYRGLPYNSANCEINKLKKPMMPFSSEDNPNEVTKAHSTGYKSFDY
QQLNYEYDNLNFHGMTIPQLEVHLKKIQEKDRVFAGFLLRAIGQSADVNFDVCRKDGECT
FGGTFCVLGGDYEMPWAFDRLFLYDISKSLVHLRLDAHDDFDIKVTIMGIDGKSLPPNLL
PSPTILFKPGTGKI
>6R839a:Hemocyanin subunit 1
NLLRKNVDTLTPDEILNLQVSLRAMQDDEGASGYQAISAYHGEPADCKAADGSTIVCCLH
GMPTFPMWHRLYLVQFEQALVAHGSTLGIPYWDWTKPMTQLPELVQHPLFIDPTGKKAKK
NVFYSGEIKFENKVTARAVDARLYQASQEGQKNFLLEGVLNALEQEDFCHFEVQLEVAHN
PIHYLVGGRFTHSMSSLEYTSYDPLFFLHHSNVERHFALWQALQKHRGLPTRPNCGLNLF
HSPMEPFGRDTNPFAITKDNSKASSLFDYEHLGYAFDDLSLNGMTIEELEALLKQRRSGA
RAFANFRLGGIKTSANVRIKLCIPTEDKRQSDNCDNDAGQFFILGGTNEMPWNFAFPYLH
EITDTVLSLGLALDSNYYVTAEVTAINGTLMPTQTIPRPIVTYIPPQGFKDVNMVNMDTS
SLRFRKDISSLTTEEEYELRVAMERFMSDKSINGYQALAEFHGLPAKCPRPDALNRVACC
IHGMATFPHWHRLVVMQFENALFTRGSPIGVPYWDWTKPFTALPSLLADETYVDPYTKET
KPNPFFKAPIEFLKAGVHTSRQIDERLFKQPSKGDHGFLYDGLSLAFEQDDFCDFEVQFE
VTHNSIHAWTGGSEPYSMSSLHYTSFDPMFWLHHSQVDRLWAIWQALQIQRGKPYKTYCA
NSEVYRPMKPFAFKSPLNNDEKTREHSVPTDVYDYQAELAYTYDTLFFGGLSIRELQRYV
EEAKSKDRVFAGFLLMGIQTSANVDLFVVAGGNEFFVGSIAVLGGSKEMTWRFDRVYKHE
ITDALGALGVDMFAEYTLRVDIKDVNGTALPPTAIPPPIVIFVPGIADANVKFDEQHRSR
KNVDSMTVSEMNALRTAMAAFAADKEVTGYQQVAAFHGSTQWCPSPDAAQKYACCHHGMA
TFPHWHRLIALNFENGLRRNGWSGGLPYWDWTRPIDALPALVLEAEYTDANGEAKPNPFF
SGAIDSIGASTSRAPTEALYEKPDFGKYTHLANEIISALEQEDFCDFEVQYEIAHNHIHA
LVGGTEAVSMASLEYSAFDPIFMLHHSNVDRIWATWQALQKFRGKAYNSANCAIEILRKP
MSPFSLASDINPDAMTREYSVPFDVFNYKKNFHYEYDTLELNGLSIXQLSREINRRKAKN
RVXVTFMLEGLKKSLLVEYFIAADGTDQKMKAGEFYVLGSENEMPWKFDRPYKSDITYVM
DAMKLHYTDKYHVELRITDMTGAEVTDLKLVTSVIYEPGIGNFGEGRRWISPITSASRIR
KNLLDFEDGEMESLRNAFKQMADEGRYEEIASFHGVPAQCPSEDGTMVHTCCLHGMPVFP
HWHRLYVSLVEDELLARGSGVAVPYWDWVEPFDELPRLINEATFYNSRTLQIEPNPFFKG
KISFENAETDRDTQPELFGNRYLYDHTLFVFEQTDFCEFEVHYEVLHNTIHSWLGGRDVH
SMSSLDYAAYDPVFFLHHSNVDRLWAIWQELQRYRKLSYNEANCALPLMNQPMRPFSNST
ANNDRLTFTNSRPNDVFDYQNVLHYKYDTLNFAGLSIPQLERILQKNQGRDRIFAGFLLH
GIKASADVRIYICVPTGIGEENCGNYAGIFSVLGGETEMPWQFDRLFRYEITDELKKLGL
NQNSHFRVEMELTAVNGSKITQKIFPNPTIIFVPSDVEFEEDTWRDVVTSANRIRRNLKD
LSKEDMFSLRAAFKRMTDDGRYEEIAAFHGLPAQCPNADGSNIHTCCLHGMPTFPHWHRL
YLSLVENELLARGSDVAVPYWDWIEPFDSLPGLISDETYKHPKTNEDIENPFHHGKISFA
DAVTVRKPRDQLFNNRYLYEHALFAFEHTDFCDFEVHFEVLHNSIHSWIGGPNPHSMSSL
DFAAYDPIFFLHHSTVDRLWAIWQDLQRYRKLDYNVANCALNLLNDPMRPFNNKTANQDH
LTFTNSRPNDVFDYQNSLNYKFDSLSFSGLSIPRLDDLLESRQSHDRVFAGFWLSGIKAS
ADVNIHICVPIGVEHEDCDNYAGTFAVLGGETEMPWAFDRLFRYEISDEMKKLQLTEDSK
FRLTTNIIASNGSKVSNDIFPTPTVIFVPKKERTEQVSTTKSVRGNLVRKNVDRLSLQEI
NSLIHALKRMQKDRSSDGFETIASFHALPPLCPNPTAKHRHACCLHGMATFPQWHRLYVV
QFEHSLNRHGAIVGVPYWDWTYPMTEVPGLLTSEKYTDPFTGIETFNPFNHGHISFISPE
TMTTREVSEHLFEQPALGKQTWLFNNIILALEQTDYCDFEVQFEIVHNSIHSWLGGKELY
SLNHLHYAAYDPAFFLHHSNVDRLWVVWQELQKFRGLPAYESNCAIELMSQPLKPFSFGA
PYNLNPVTTKYSKPSDVFNYKQNFHYEYDMLEMNGMSIAQLESYIRQERQKDRVFAGFLL
EGFGSSAYATFQVCPDVGDCYEGSHFSVLGGSTEMPWAFDRLYKMEITDILQAMDLKFDS
HFTIKTKIVAHNGTELPESLLPEATIVRIPPSAQNLEVAIPLNRIRRNINSLESRDVQNL
MSALKRLKEDESDFGFQTIAGYHGSLMCPTPEAPEYACCLHGMPTFMHWHRVYLLHFEES
MRRHGASVAVPYWDWTMPSDNLPSLLGDADYYDAWTDSVIENPFLRGHIKYEDTYTVREI
QPELFALAEGQKESTLFKDVMLMFEQEDYCDFEVQAEVIHNSIHYLIGGHQKYAMSSLMF
SSFDPIFYVHHSMVDRLWAIWQELQKHRKLPHDKAYCALDQMAFPMKPFIWESNPNPTTR
AVSTPSKLFDYKSLGYDYDHLNFHGMSIGQLEALIQKQKKADRVFAGFLLHGIKISADVH
LKICIEADCQEAGVIFVLGGETEMPWHFDRNYKMDITDVLKKRNIPPEALFEHDSKIRLE
VEIKSVDGAVLDPNSLPKPSLIYAPAKGLIIQQVGEYDAGSMVRKNVNSLTPSEIENLRN
ALAAVQADKTDAGYQKIASFHGMPLSCQYPDGTAFACCQHGMVTFPHWHRLYMKQMEDAL
KAKGAKIGIPYWDWTTAFHSLPILVTEPKNNPFHHGYIDVADTKTTRDPRPQLFDDPEQG
DQSFFYRQIAFALEQRDFCDFEIQFEMGHNAIHSWVGGPSPYGMSTLHYTSYDPLFYVHH
SNTDRIWAIWQALQKYRGLPYNSANCEINKLKKPMMPFSSEDNPNEVTKAHSTGYKSFDY
QQLNYEYDNLNFHGMTIPQLEVHLKKIQEKDRVFAGFLLRAIGQSADVNFDVCRKDGECT
FGGTFCVLGGDYEMPWAFDRLFLYDISKSLVHLRLDAHDDFDIKVTIMGIDGKSLPPNLL
PSPTILFKPGTGKI
>6R8310a:Hemocyanin subunit 1
NLLRKNVDTLTPDEILNLQVSLRAMQDDEGASGYQAISAYHGEPADCKAADGSTIVCCLH
GMPTFPMWHRLYLVQFEQALVAHGSTLGIPYWDWTKPMTQLPELVQHPLFIDPTGKKAKK
NVFYSGEIKFENKVTARAVDARLYQASQEGQKNFLLEGVLNALEQEDFCHFEVQLEVAHN
PIHYLVGGRFTHSMSSLEYTSYDPLFFLHHSNVERHFALWQALQKHRGLPTRPNCGLNLF
HSPMEPFGRDTNPFAITKDNSKASSLFDYEHLGYAFDDLSLNGMTIEELEALLKQRRSGA
RAFANFRLGGIKTSANVRIKLCIPTEDKRQSDNCDNDAGQFFILGGTNEMPWNFAFPYLH
EITDTVLSLGLALDSNYYVTAEVTAINGTLMPTQTIPRPIVTYIPPQGFKDVNMVNMDTS
SLRFRKDISSLTTEEEYELRVAMERFMSDKSINGYQALAEFHGLPAKCPRPDALNRVACC
IHGMATFPHWHRLVVMQFENALFTRGSPIGVPYWDWTKPFTALPSLLADETYVDPYTKET
KPNPFFKAPIEFLKAGVHTSRQIDERLFKQPSKGDHGFLYDGLSLAFEQDDFCDFEVQFE
VTHNSIHAWTGGSEPYSMSSLHYTSFDPMFWLHHSQVDRLWAIWQALQIQRGKPYKTYCA
NSEVYRPMKPFAFKSPLNNDEKTREHSVPTDVYDYQAELAYTYDTLFFGGLSIRELQRYV
EEAKSKDRVFAGFLLMGIQTSANVDLFVVAGGNEFFVGSIAVLGGSKEMTWRFDRVYKHE
ITDALGALGVDMFAEYTLRVDIKDVNGTALPPTAIPPPIVIFVPGIADANVKFDEQHRSR
KNVDSMTVSEMNALRTAMAAFAADKEVTGYQQVAAFHGSTQWCPSPDAAQKYACCHHGMA
TFPHWHRLIALNFENGLRRNGWSGGLPYWDWTRPIDALPALVLEAEYTDANGEAKPNPFF
SGAIDSIGASTSRAPTEALYEKPDFGKYTHLANEIISALEQEDFCDFEVQYEIAHNHIHA
LVGGTEAVSMASLEYSAFDPIFMLHHSNVDRIWATWQALQKFRGKAYNSANCAIEILRKP
MSPFSLASDINPDAMTREYSVPFDVFNYKKNFHYEYDTLELNGLSIXQLSREINRRKAKN
RVXVTFMLEGLKKSLLVEYFIAADGTDQKMKAGEFYVLGSENEMPWKFDRPYKSDITYVM
DAMKLHYTDKYHVELRITDMTGAEVTDLKLVTSVIYEPGIGNFGEGRRWISPITSASRIR
KNLLDFEDGEMESLRNAFKQMADEGRYEEIASFHGVPAQCPSEDGTMVHTCCLHGMPVFP
HWHRLYVSLVEDELLARGSGVAVPYWDWVEPFDELPRLINEATFYNSRTLQIEPNPFFKG
KISFENAETDRDTQPELFGNRYLYDHTLFVFEQTDFCEFEVHYEVLHNTIHSWLGGRDVH
SMSSLDYAAYDPVFFLHHSNVDRLWAIWQELQRYRKLSYNEANCALPLMNQPMRPFSNST
ANNDRLTFTNSRPNDVFDYQNVLHYKYDTLNFAGLSIPQLERILQKNQGRDRIFAGFLLH
GIKASADVRIYICVPTGIGEENCGNYAGIFSVLGGETEMPWQFDRLFRYEITDELKKLGL
NQNSHFRVEMELTAVNGSKITQKIFPNPTIIFVPSDVEFEEDTWRDVVTSANRIRRNLKD
LSKEDMFSLRAAFKRMTDDGRYEEIAAFHGLPAQCPNADGSNIHTCCLHGMPTFPHWHRL
YLSLVENELLARGSDVAVPYWDWIEPFDSLPGLISDETYKHPKTNEDIENPFHHGKISFA
DAVTVRKPRDQLFNNRYLYEHALFAFEHTDFCDFEVHFEVLHNSIHSWIGGPNPHSMSSL
DFAAYDPIFFLHHSTVDRLWAIWQDLQRYRKLDYNVANCALNLLNDPMRPFNNKTANQDH
LTFTNSRPNDVFDYQNSLNYKFDSLSFSGLSIPRLDDLLESRQSHDRVFAGFWLSGIKAS
ADVNIHICVPIGVEHEDCDNYAGTFAVLGGETEMPWAFDRLFRYEISDEMKKLQLTEDSK
FRLTTNIIASNGSKVSNDIFPTPTVIFVPKKERTEQVSTTKSVRGNLVRKNVDRLSLQEI
NSLIHALKRMQKDRSSDGFETIASFHALPPLCPNPTAKHRHACCLHGMATFPQWHRLYVV
QFEHSLNRHGAIVGVPYWDWTYPMTEVPGLLTSEKYTDPFTGIETFNPFNHGHISFISPE
TMTTREVSEHLFEQPALGKQTWLFNNIILALEQTDYCDFEVQFEIVHNSIHSWLGGKELY
SLNHLHYAAYDPAFFLHHSNVDRLWVVWQELQKFRGLPAYESNCAIELMSQPLKPFSFGA
PYNLNPVTTKYSKPSDVFNYKQNFHYEYDMLEMNGMSIAQLESYIRQERQKDRVFAGFLL
EGFGSSAYATFQVCPDVGDCYEGSHFSVLGGSTEMPWAFDRLYKMEITDILQAMDLKFDS
HFTIKTKIVAHNGTELPESLLPEATIVRIPPSAQNLEVAIPLNRIRRNINSLESRDVQNL
MSALKRLKEDESDFGFQTIAGYHGSLMCPTPEAPEYACCLHGMPTFMHWHRVYLLHFEES
MRRHGASVAVPYWDWTMPSDNLPSLLGDADYYDAWTDSVIENPFLRGHIKYEDTYTVREI
QPELFALAEGQKESTLFKDVMLMFEQEDYCDFEVQAEVIHNSIHYLIGGHQKYAMSSLMF
SSFDPIFYVHHSMVDRLWAIWQELQKHRKLPHDKAYCALDQMAFPMKPFIWESNPNPTTR
AVSTPSKLFDYKSLGYDYDHLNFHGMSIGQLEALIQKQKKADRVFAGFLLHGIKISADVH
LKICIEADCQEAGVIFVLGGETEMPWHFDRNYKMDITDVLKKRNIPPEALFEHDSKIRLE
VEIKSVDGAVLDPNSLPKPSLIYAPAKGLIIQQVGEYDAGSMVRKNVNSLTPSEIENLRN
ALAAVQADKTDAGYQKIASFHGMPLSCQYPDGTAFACCQHGMVTFPHWHRLYMKQMEDAL
KAKGAKIGIPYWDWTTAFHSLPILVTEPKNNPFHHGYIDVADTKTTRDPRPQLFDDPEQG
DQSFFYRQIAFALEQRDFCDFEIQFEMGHNAIHSWVGGPSPYGMSTLHYTSYDPLFYVHH
SNTDRIWAIWQALQKYRGLPYNSANCEINKLKKPMMPFSSEDNPNEVTKAHSTGYKSFDY
QQLNYEYDNLNFHGMTIPQLEVHLKKIQEKDRVFAGFLLRAIGQSADVNFDVCRKDGECT
FGGTFCVLGGDYEMPWAFDRLFLYDISKSLVHLRLDAHDDFDIKVTIMGIDGKSLPPNLL
PSPTILFKPGTGKI
166594
PDB entries from 2020-07-15