Sequence (fasta): 6oh7Download

>6OH7A:Labdane-related diterpene synthase
MTDTDDGGTMLPLPDFTATFPEPFPAGPHSERTEHRLLDWLEEHPLLPSAKAKAVLVNIT
SHGASRTFPTADADDLLLFAELLLWLTAFDDVHAEGNGVGGPAALVDRASELMLVLAGGN
PPRAMSPFPAVLHDLLARFRARASAAAYHRLAASLRDTLMALVWEAHHVAKPEGVALATY
LAMRPHTVFIKTITAAGEILLGYELTDTQRALAAVRNLETAVANLAGWINDLASYEREMQ
RGRGQPLSLPTLLHARHGGTIEEAFTRASSMCENEAAVARRGITHLAHASPNALTAHARA
LEDITRSFIWHTSHARYQGIRPNRGSSTSSPARSLQHHHHHH