Sequence (fasta): 6ogzDownload

>6OGZB:RNA (5'-R(P*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*A)-3')
UAUAUAUAUAUAUAUAUA
>6OGZC:RNA (5'-R(P*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*UP*A)-3')
AUAUAUAUAUAUAUAUA
>6OGZA:RNA-dependent RNA polymerase of rotavirus A
MGKYNLILSEYLSFIYNSQSAVQIPIYYSSNSELENRCIEFHSKCLENSKNGLSLKKLFV
EYSDVIENATLLSILSYSYDKYNAVERKLVKYAKGKPLEADLTVNELDYENNKITSELFP
TAEEYTDLLMDPAILTSLSSNLNAVMFWLEKHENDVAEKLKIYKRRLDLFTIVASTVNKY
GVPRHNAKYRYEYEVMKDKPYYLVTWANSSIEMLMSVFSHEDYLIARELIVLSYSNRSTL
AKLVSSPMSILVALVDINGTFITNEELELEFSNKYVRAIVPDQTFDELKQMLDNMRKAGL
TDIPKMIQDWLVDCSIEKFPLMAKIYSWSFHVGFRKQKMLDAALDQLKTEYTEDVDDEMY
REYTMLIRDEVVKMLEEPVKHDDHLLQDSELAGLLSMSSASNGESRQLKFGRKTIFSTKK
NMHVMDDMANGRYTPGIIPPVNVDKPIPLGRRDVPGRRTRIIFILPYEYFIAQHAVVEKM
LIYAKHTREYAEFYSQSNQLLSYGDVTRFLSNNSMVLYTDVSQWDSSQHNTQPFRKGIIM
GLDMLANMTNDARVIQTLNLYKQTQINLMDSYVQIPDGNVIKKIQYGAVASGEKQTKAAN
SIANLALIKTVLSRISNKYSFATKIIRVDGDDNYAVLQFNTEVTKQMVQDVSNDVRETYA
RMNTKVKALVSTVGIEIAKRYIAGGKIFFRAGINLLNNEKKGQSTQWDQAAVLYSNYIVN
RLRGFETDREFILTKIMQMTSVAITGSLRLFPSERVLTTNSTFKVFDSEDFIIEYGTTDD
EVYIQRAFMSLSSQKSGIADEIAASSTFKNYVSRLSEQLLFSKNNIVSRGIALTEKAKLN
SYAPISLEKRRAQISALLTMLQKPVTFKSSKITINDILRDIKPFFTVNEAHLPIQYQKFM
PTLPDNVQYIIQCIGSRTYQIEDDGSKSAISRLISKYSVYKPSIEELYKVISLHENEIQL
YLISLGIPKIDADTYVGSKIYSQDKYRILESYVYNLLSINYGCYQLFDFNSPDLEKLIRI
PFKGKIPAVTFILHLYAKLEVINHAIKNGSWISLFCNYPKSEMIKLWKKMWNITSLRSPY
TNANFFQD
>6OGZE:Inner capsid protein VP2
MAYRKRGARRETNLKQDDRMQEKEENKNVNTNSENKNATKPQLSEKVLSQKEEVITDNQE
EIKIADEVKKSNKEESKQLLEVLKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKP
EQVKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQV
LTEMPDYLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQ
ADRNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLP
STARYIRPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDL
QLEALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTV
VPNDMFIRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLH
FVNNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGI
LLLSNRLGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATV
IPSPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFD
ISRVPDDQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLE
RDEMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQPVALVGALPFITDSSVIS
LVAKLDATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQF
DFRASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMRIMNEL
>6OGZF:Inner capsid protein VP2
MAYRKRGARRETNLKQDDRMQEKEENKNVNTNSENKNATKPQLSEKVLSQKEEVITDNQE
EIKIADEVKKSNKEESKQLLEVLKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKP
EQVKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQV
LTEMPDYLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQ
ADRNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLP
STARYIRPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDL
QLEALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTV
VPNDMFIRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLH
FVNNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGI
LLLSNRLGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATV
IPSPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFD
ISRVPDDQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLE
RDEMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQPVALVGALPFITDSSVIS
LVAKLDATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQF
DFRASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMRIMNEL
>6OGZG:Inner capsid protein VP2
MAYRKRGARRETNLKQDDRMQEKEENKNVNTNSENKNATKPQLSEKVLSQKEEVITDNQE
EIKIADEVKKSNKEESKQLLEVLKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKP
EQVKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQV
LTEMPDYLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQ
ADRNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLP
STARYIRPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDL
QLEALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTV
VPNDMFIRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLH
FVNNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGI
LLLSNRLGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATV
IPSPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFD
ISRVPDDQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLE
RDEMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQPVALVGALPFITDSSVIS
LVAKLDATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQF
DFRASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMRIMNEL
>6OGZI:Inner capsid protein VP2
MAYRKRGARRETNLKQDDRMQEKEENKNVNTNSENKNATKPQLSEKVLSQKEEVITDNQE
EIKIADEVKKSNKEESKQLLEVLKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKP
EQVKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQV
LTEMPDYLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQ
ADRNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLP
STARYIRPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDL
QLEALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTV
VPNDMFIRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLH
FVNNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGI
LLLSNRLGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATV
IPSPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFD
ISRVPDDQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLE
RDEMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQPVALVGALPFITDSSVIS
LVAKLDATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQF
DFRASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMRIMNEL
>6OGZH:Inner capsid protein VP2
MAYRKRGARRETNLKQDDRMQEKEENKNVNTNSENKNATKPQLSEKVLSQKEEVITDNQE
EIKIADEVKKSNKEESKQLLEVLKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKP
EQVKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQV
LTEMPDYLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQ
ADRNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLP
STARYIRPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDL
QLEALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTV
VPNDMFIRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLH
FVNNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGI
LLLSNRLGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATV
IPSPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFD
ISRVPDDQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLE
RDEMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQPVALVGALPFITDSSVIS
LVAKLDATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQF
DFRASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMRIMNEL
>6OGZJ:Inner capsid protein VP2
MAYRKRGARRETNLKQDDRMQEKEENKNVNTNSENKNATKPQLSEKVLSQKEEVITDNQE
EIKIADEVKKSNKEESKQLLEVLKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKP
EQVKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQV
LTEMPDYLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQ
ADRNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLP
STARYIRPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDL
QLEALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTV
VPNDMFIRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLH
FVNNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGI
LLLSNRLGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATV
IPSPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFD
ISRVPDDQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLE
RDEMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQPVALVGALPFITDSSVIS
LVAKLDATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQF
DFRASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMRIMNEL
>6OGZK:Inner capsid protein VP2
MAYRKRGARRETNLKQDDRMQEKEENKNVNTNSENKNATKPQLSEKVLSQKEEVITDNQE
EIKIADEVKKSNKEESKQLLEVLKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKP
EQVKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQV
LTEMPDYLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQ
ADRNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLP
STARYIRPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDL
QLEALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTV
VPNDMFIRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLH
FVNNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGI
LLLSNRLGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATV
IPSPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFD
ISRVPDDQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLE
RDEMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQPVALVGALPFITDSSVIS
LVAKLDATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQF
DFRASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMRIMNEL
>6OGZL:Inner capsid protein VP2
MAYRKRGARRETNLKQDDRMQEKEENKNVNTNSENKNATKPQLSEKVLSQKEEVITDNQE
EIKIADEVKKSNKEESKQLLEVLKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKP
EQVKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQV
LTEMPDYLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQ
ADRNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLP
STARYIRPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDL
QLEALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTV
VPNDMFIRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLH
FVNNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGI
LLLSNRLGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATV
IPSPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFD
ISRVPDDQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLE
RDEMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQPVALVGALPFITDSSVIS
LVAKLDATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQF
DFRASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMRIMNEL
>6OGZM:Inner capsid protein VP2
MAYRKRGARRETNLKQDDRMQEKEENKNVNTNSENKNATKPQLSEKVLSQKEEVITDNQE
EIKIADEVKKSNKEESKQLLEVLKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKP
EQVKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQV
LTEMPDYLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQ
ADRNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLP
STARYIRPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDL
QLEALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTV
VPNDMFIRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLH
FVNNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGI
LLLSNRLGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATV
IPSPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFD
ISRVPDDQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLE
RDEMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQPVALVGALPFITDSSVIS
LVAKLDATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQF
DFRASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMRIMNEL
>6OGZN:Inner capsid protein VP2
MAYRKRGARRETNLKQDDRMQEKEENKNVNTNSENKNATKPQLSEKVLSQKEEVITDNQE
EIKIADEVKKSNKEESKQLLEVLKTKEEHQKEVQYEILQKTIPTFEPKESILKKLEDIKP
EQVKKQTKLFRIFEPRQLPVYRANGEKELRNRWYWKLKRDTLPDGDYDVREYFLNLYDQV
LTEMPDYLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEGVVRRFIAEMRQRVQ
ADRNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLP
STARYIRPNLLQDRLNLHDNFESLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDL
QLEALTIQSETQFLTGINSQAANDCFKTLIAAMLSQRTMSLDFVTTNYMSLISGMWLLTV
VPNDMFIRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIAEQQIQNFQVANWLH
FVNNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGI
LLLSNRLGQLVDLTRLLAYNYETLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATV
IPSPQTLFHYYNVNVNFHSNYNERINDAVAIITAANRLNLYQKKMKSIVEDFLKRLQIFD
ISRVPDDQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKIAQGVIIAYRDMQLE
RDEMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQPVALVGALPFITDSSVIS
LVAKLDATVFAQIVKLRKVDTLKPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQF
DFRASMHMLTSNLTFTVYSDLLAFVSADTVEPINAVAFDNMRIMNEL