Sequence (fasta): 6njdDownload

>6NJDA:Di-ubiquitin
GPLGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
LSDYNIQKESTLHLVLRLRSSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPD
QQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
>6NJDC:Di-ubiquitin
GPLGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
LSDYNIQKESTLHLVLRLRSSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPD
QQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
>6NJDB:RavD
GPLGSMNLKAEVFLNQNCAEMMIKKAAQLILGSDLDFEYTRGIQDIQVDLGPAFMFSPDE
EKTLWVSGKNQETLEKDLATLNKSSVYFFRTGTQGGAGHWQVLYYEAAKSGWVSYSSQSN
HFQVTDSNGKLTASGKGLLVPHANWGKENGNYAFLLVNASAENIIHAANFVYILRTQNEV
AAIEYCALNHEFHPEIKRTARAKAE
>6NJDD:RavD
GPLGSMNLKAEVFLNQNCAEMMIKKAAQLILGSDLDFEYTRGIQDIQVDLGPAFMFSPDE
EKTLWVSGKNQETLEKDLATLNKSSVYFFRTGTQGGAGHWQVLYYEAAKSGWVSYSSQSN
HFQVTDSNGKLTASGKGLLVPHANWGKENGNYAFLLVNASAENIIHAANFVYILRTQNEV
AAIEYCALNHEFHPEIKRTARAKAE