Sequence (fasta): 6nd4Download

>6ND40:5'ETS rRNA
AUGCGAAAGCAGUUGAAGACAAGUNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCUUG
UCGUUCGUUAUGUUUUUGUAAAUGGCCUCGUCAAACGGUGGAGAGAGUCGCUAGGUGAUC
GUCAGAUCUGCCUAGUCUCUAUACAGCGUGUUUAAUUGACAUGGGUUGAUGCGUAUUGAG
AGAUACAAUUUGGGAAGAAAUUCCCAGAGUGUGUUUCUUUUGCGUUUAACCUGAACAGUC
UCAUCGUGGGCAUCUUGCGAUUCCAUUGGUGAGCAGCGAAGGAUUUGGUGGAUUACUAGC
UAAUAGCAAUCUAUUUCAAAGAAUUCAAACUUGGGGGAAUGCCUUGUUGAAUAGCCGGUC
GCAAGACUGUGAUUCUUCAAGUGUAACCUCCUCUCAAAUCAGCGAUAUCAAACGUACCAU
UCCGUGAAACACCGGGGUAUCUGUUUGGUGGAACCUGAUUAGAGGAAACUCAAAGAGUGC
UAUGGUAUGGUGACGGAGUGCGCUGGUCAAGAGUGUAAAAGCUUUUUGAACAGAGAGCAU
UUCCGGCAGCAGAGAGACCUGAAAAAGCAAUUUUUCUGGAAUUUCAGCUGUUNNNNNNNN
NNAUAAGUAUCUUCUAGCAAGAGGGAAUAGGUGGGAAAAAAAAAAAGAGAUUUCGGUUUC
UUUCUUUUUUACUGCUUGUUGCUUCUUCUUUUAAGAUAGU
>6ND4N:Utp4
MSSSLLSVLKEKSRSLKIRNKPVKMTSQERMIVHRCRFVDFTPATITSLAFSHKSNINKL
TPSDLRLAIGRSNGNIEIWNPRNNWFQEMVIEGGKDRSIEGLCWSNVNGESLRLFSIGGS
TVVTEWDLATGLPLRNYDCNSGVIWSISINDSQDKLSVGCDNGTVVLIDISGGPGVLEHD
TILMRQEARVLTLAWKKDDFVIGGCSDGRIRIWSAQKNDENMGRLLHTMKVDKAKKESTL
VWSVIYLPRTDQIASGDSTGSIKFWDFQFATLNQSFKAHDADVLCLTTDTDNNYVFSAGV
DRKIFQFSQNTNKSQKNNRWVNSSNRLLHGNDIRAICAYQSKGADFLVSGGVEKTLVINS
LTSFSNGNYRKMPTVEPYSKNVLVNKEQRLVVSWSESTVKIWTMGTDSSTEQNYKLVCKL
TLKDDQNISTCSLSPDGQVLVVGRPSTTKVFHLQPVGNKLKVTKLDNDLLLRTSTKLVKF
IDNSKIVICSCEDDVFIVDLESEEDEKPQEVELLEVTSTKSSIKVPYINRINHLEVDQNI
AVISRGCGVVDILDLKARISKPLARLNNFITAVHINTSRKSVVVITADNKIYEFNMNLNS
EAENEDSESVLTQWSKNNTDNLPKEWKTLKENCVGIFSDIENSSRLWFWGATWISRIDFD
VDFPINKXXXXXXXXXXXXXXHFFFTDKYKPLLFVDLISSNELAIIERNPLTFHSKQKAF
IQPKLVF
>6ND4O:Utp1
MKSDFKFSNLLGTVYRQGNITFSDDGKQLLSPVGNRVSVFDLINNKSFTFEYEHRKNIAA
IDLNKQGTLLISIDEDGRAILVNFKARNVLHHFNFKEKCSAVKFSPDGRLFALASGRFLQ
IWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEK
NLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFTKRPSDDDDNESEDDDKQEE
VDISKYSWRITKKHFFYANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSM
GQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRV
VTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYR
NFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLS
FSQENSVLASASWDKTIRIWSIFGRSQQVEPIEVYSDVLALSMRPDGKEVAVSTLKGQIS
IFNIEDAKQVGNIDCRKDIISGRFNQDRFTAKNSERSKFFTTIHYSFDGMAIVAGGNNNS
ICLYDVPNEVLLKRFIVSRNMALNGTLEFLNSKKMTEAGSLDLIDDAGENSDLEDRIDNS
LPGSQRGGDLSTRKMRPEVRVTSVQFSPTANAFAAASTEGLLIYSTNDTILFDPFDLDVD
VTPHSTVEALREKQFLNALVMAFRLNEEYLINKVYEAIPIKEIPLVASNIPAIYLPRILK
FIGDFAIESQHIEFNLIWIKALLSASGGYINEHKYLFSTAMRSIQRFIVRVAKEVVNTTT
DNKYTYRFLVSTDGSMEDGAADDDEVLLKDDADEDNEENEENDVVMESDDEEGWIGFNGK
DNKLPLSNENDSSDEEENEKELP
>6ND4P:Utp6
MSKTRYYLEQCIPEMDDLVEKGLFTKNEVSLIMKKRTDFEHRLNSRGSSINDYIKYINYE
SNVNKLRAKRCKRILQVKKTNSLSDWSIQQRIGFIYQRGTNKFPQDLKFWAMYLNYMKAR
GNQTSYKKIHNIYNQLLKLHPTNVDIWISCAKYEYEVHANFKSCRNIFQNGLRFNPDVPK
LWYEYVKFELNFITKLINRRKVMGLINEREQELDMQNEQKNNQAPDEEKSHLQVPSTGDS
MKDKLNELPEADISVLGNAETNPALRGDIALTIFDVCMKTLGKHYINKHKGYYAISDSKM
NIELNKETLNYLFSESLRYIKLFDEFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
X
>6ND4Q:Utp12
MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLV
SKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH
KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST
SKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGG
KLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKRE
KRLKEXXXXXXXXXXYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSNTIEYY
SIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIKTHKCI
RTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDG
KRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRY
LAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG
DCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAV
ATDGGFVVSSSHDHSIRIWEETEDXXXXXXXXXXXXXXXXXXXXXXXXXSGVHKQTLESL
KAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKKLGEAPIKPQGNAVLIAVNKTPEQYIM
DTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVMQNKTLLHSHLPLICKNLFFIIKFNHK
ELVSQKNEELKLQINRVKTELRSALKSTEDDLGFNVQGLKFVKQQWNLRHNYEFVDEYDQ
QEKESNSARKRVFGTVI
>6ND4R:Utp13
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXEQEIEEEQEKAKLQVEQEQSLQNYMSKGDWTNA
FLLAMTLDHPMRLFNVLKRALGESRSRQDTEEGKIEVIFNEELDQAISILNDEQLILLMK
RCRDWNTNAKTHTIAQRTIRCILMHHNIAKLSEIPGMVKIVDAIIPYTQRHFTRVDNLVE
QSYILDYALVEMDKLF
>6ND4S:Utp18
MTMATTAMNVSVPPPDEEEQLLAKFVFGDTTDLQENLAKFNADFIFNEQEMDVEDQEDEG
SESDNSEEDEAQNGELDHVNNDQLFFVDDGGNEDSQDKNEDTMDVDDEDDSSSDDYSEDS
EEAAWIDSDDEKIKVPILVTNKTKKLRTSYNESKINGVHYINRLRSQFEKIYPRPKWVDD
ESDSELDDEEDDEEEGSNNVINGDINALTKILSTTYNYKDTLSNSKLLPPKKLDIVRLKD
ANASHPSHSAIQSLSFHPSKPLLLTGGYDKTLRIYHIDGKTNHLVTSLHLVGSPIQTCTF
YTSLSNQNQQNIFTAGRRRYMHSWDLSLENLTHSQTAKIEKFSRLYGHESTQRSFENFKV
AHLQNSQTNSVHGIVLLQGNNGWINILHSTSGLWLMGCKIEGVITDFCIDYQPISRGKFR
TILIAVNAYGEVWEFDLNKNGHVIRRWKDQGGVGITKIQVGGGTTTTCPALQISKIKQNR
WLAVGSESGFVNLYDRNNAMTSSTPTPVAALDQLTTTISNLQFSPDGQILCMASRAVKDA
LRLVHLPSCSVFSNWPTSGTPLGKVTSVAFSPSGGLLAVGNEQGKVRLWKLNHY
>6ND4T:Utp21
MSIDLKKRKVEEDVRSRGKNSKIFSPFRIIGNVSNGVPFATGTLGSTFYIVTCVGKTFQI
YDANTLHLLFVSEKETPSSIVALSAHFHYVYAAYENKVGIYKRGIEEHLLELETDANVEH
LCIFGDYLCASTDDNSIFIYKKSDPQDKYPSEFYTKLTVTEIQGGEIVSLQHLATYLNKL
TVVTKSNVLLFNVRTGKLVFTSNEFPDQITTAEPAPVLDIIALGTVTGEVIMFNMRKGKR
IRTIKIPQSRISSLSFRTDGSSHLSVGTSSGDLIFYDLDRRSRIHVLKNIHRESYGGVTQ
ATFLNGQPIIVTSGGDNSLKEYVFDPSLSQGSGDVVVQPPRYLRSRGGHSQPPSYIAFAD
SQSHFMLSASKDRSLWSFSLRKDAQSQEMSQRLHKKQDGGRVGGSTIKSKFPEIVALAIE
NARIGEWENIITAHKDEKFARTWDMRNKRVGRWTFDTTDDGFVKSVAMSQCGNFGFIGSS
NGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKSTLLGKL
KLDAPITAMVYHRSSDLFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWI
VSASLDSTIRTWDLPTGGCIDGIIVDNVATNVKFSPNGDLLATTHVTGNGICIWTNRAQF
KTVSTRTIDESEFARMALPSTSVRGNDSMLSGALESNGGEDLNDIDFNTYTSLEQIDKEL
LTLSIGPRSKMNTLLHLDVIRKRSKPKEAPKKSEKLPFFLQLSGEKVGDEASVREGIAHE
TPEEIHRRDQEAQKKLDAEEQMNKFKVTGRLGFESHFTKQLREGSQSKDYSSLLATLINF
SPAAVDLEIRSLNSFEPFDEIVWFIDALTQGLKSNKNFELYETFMSLLFKAHGDVIHANN
KNQDIASALQNWEDVHKKEDRLDDLVKFCMGVAAFVTTA
>6ND4U:Sof1
MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKLERMFAKPFVG
QLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQ
PRFHDKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGES
AFQGIDSHRENSTFATGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGS
DNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV
FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQVKYSMDS
KYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKLKERFRHMPEIKRISRHRHVP
QVIKKAQEIKNIELSSIKRREANERRTRKDMPYISERKKQIVGTVHKYEDSGRDRKRRKE
DDKRDTQEK
>6ND4W:Utp7
MGHKKNGHRRQIKERENQNKFERSTYTNNAKNNHTQTKDKKLRAGLKKIDEQYKKAVSSA
AATDYLLPESNGYLEPENELEKTFKVQQSEIKSSVDVSTANKALDLSLKEFGPYHIKYAK
NGTHLLITGRKGHVASMDWRKGQLRAELFLNETCHSATYLQNEQYFAVAQKKYTFIYDHE
GTELHRLKQHIEARHLDFLPYHYLLVTAGETGWLKYHDVSTGQLVSELRTKAGPTMAMAQ
NPWNAVMHLGHSNGTVSLWSPSMPEPLVKLLSARGPVNSIAIDRSGYYMATTGADRSMKI
WDIRNFKQLHSVESLPTPGTNVSISDTGLLALSRGPHVTLWKDALKLSGDSKPCFGSMGG
NPHRNTPYMSHLFAGNKVENLGFVPFEDLLGVGHQTGITNLIVPGAGEANYDALELNPFE
TKKQRQEQEVRTLLNKLPADTITLDPNSIGSVDKRSSTIRLNAKDLAQTTMDANNKAKTN
SDIPDVKPDVKGKNSGLRSFLRKKTQNVIDERKLRVQKQLDKEKNIRKRNHQIKQGLISE
DHKDVIEEALSRFG
>6ND4Z:Imp3
MVRKLKHHEQKLLKKVDFLEWKQDQGHRDTQVMRTYHIQNREDYHKYNRICGDIRRLANK
LSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKSKISDLENKVTVSAICRRRLPVIMHRLKM
AETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDYVTWVDNSKIKKTLLRYRNQIDDF
DFS
>6ND41:18S rRNA 5' domain start
NNNNNNNNUGAUCCU
>6ND4A:Mpp10
MSELFGVLKSNAGRIILKDPSATSKDVKAYIDSVINTCKNGSITKKAELDEITVDGLDAN
QVWWQVKLVLDSIDGDLIQGIQELKDVVTPSHNLSDGSTLNSSSGEESELEEAESVFKEK
QMLSADVSEIEEQSNDSLSENDEEPSMDDEKTSAEAAREEFAEEKRISSGQDERHSSPDP
YGINDKFFDLEKFNRDTLAAEDSNEASEGSEDEDIDYFQDMPSDDEEEEAIYYEDFFDKP
TKEPVKKHSDVKDPKEDEELDEEEHDSAMDKVKLDLFADEEDEPNAEGVGEASDKNLSSF
EKQQIEIRKQIEQLENEAVAEKKWSLKGEVKAKDRPEDALLTEELEFDRTAKPVPVITSE
VTESLEDMIRRRIQDSNFDDLQRRTLLDITRKSQRPQFELSDVKSSKSLAEIYEDDYTRA
EDESALSEELQKAHSEISELYANLVYKLDVLSSVHFVPKPASTSLEIRVETPTISMEDAQ
PLYMSNASSLAPQEIYNVGKAEKDGEIRLKNGVAMSKEELTREDKNRLRRALKRKRSKAN
LPNVNKRSKRNDVVDTLSKAKNITVINQKGEKKDVSGKTKKSRSGPDSTNIKL
>6ND4D:Bud21
MSNGHVKFDADESQASASAVTDRQDDVLVISKKDKEVHSSSDEESDDDDAPQEEGLHSGK
SEVESQITQREEAIRLEQSQLRSKRRKQNELYAKQKKSVNETEVTDEVIAELPEELLKNI
DQKDEGSTQYSSSRHVTFDKLDESDENEEALAKAIKTKKRKTLKNLRKDSVKRGKFRVQL
LSTTQDSKTLPPKKESSIIRSKDRWLNRKALNKG
>6ND4a:Nop56
MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAA
EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCIS
NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKAXXXXXXXXXXXXX
XXXXXXXXXXXXXSETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEV
IGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFISKASAK
NKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKPTLKNELAIQE
AMELYNKDKPAAEVEETKEKESSKKRKLEDDDEEKKEKKEKKSKKEKKEKKEKKDKKEKK
DKKEKKDKKKKSKD
>6ND4b:Nop58
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDLDKELNTYAMRCKEWY
GWHFPELAKIVTDSVAYARIILTMGIRSKASETDLSEILPEEIEERVKTAAEVSMGTEIT
QTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAPNLTQLVGELVGARLIAHSGSLIS
LAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQATGKNKGKIARVLAAKAA
VSLRYDALAEDRDDSGDIGLESRAKVENRLSQLEGRDLRTTPKVVREAKKVEMTEARAYN
ADADTAKAASDSESDSDDEEEEKKEKKEKKRKRDDDEDSKDSKKAKKEKKDKKEKKEKKE
KKEKKEKKEKKEKKSKKEKKEKK
>6ND4c:Nop1.1
MSFRPGSRGGSRGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGFGGRGG
SRGGARGGSRGGRGGAAGGARGGAKVVIEPHRHAGVYIARGKEDLLVTKNMAPGESVYGE
KRISVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTS
VSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNIIPIIEDARHPQKYRMLIGMVDCV
FADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQKLREERIKP
LEQLTLEPYERDHCIVVGRYMRSGLKK
>6ND4d:Nop1.1
MSFRPGSRGGSRGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGFGGRGG
SRGGARGGSRGGRGGAAGGARGGAKVVIEPHRHAGVYIARGKEDLLVTKNMAPGESVYGE
KRISVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTS
VSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNIIPIIEDARHPQKYRMLIGMVDCV
FADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQKLREERIKP
LEQLTLEPYERDHCIVVGRYMRSGLKK
>6ND4e:Snu13
MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEP
IEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDK
IETLLI
>6ND4f:Snu13
MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEP
IEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDK
IETLLI
>6ND4g:Rrp9
MSDVTQQKKRKRSKGEVNPSKPTVDEEITDPSSNEDEQLEVSDEEDALESEEEFEGENPA
DKRRRLAKQYLENLKSEANDILTDNRNAEEKDLNNLKERTIDEYNNFDAGDLDKDIIASR
LKEDVAEQQGRVFRYFGDKLLISEAKQSFTRVGENNLTCISCFQPVLNKYTFEESSNGDK
NKGRLFAYTVSKDLQLTKYDITDFSKRPKKLKYAKGGAKYIPTSKHEYENTTEGHYDEIL
TVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVLSLAFRKNSDQLYASCA
DFKIRTYSINQFSQLEILYGHHDIVEDISALAMERCVTVGARDRTAMLWKIPDETRLTFR
GGDEPQKLLRRWMKENAKEGEDGEVKYPDESEAPLFFCEGSIDVVSMVDDFHFITGSDNG
NICLWSLAKKKPIFTERIAHGILPEPSFNDISGETDEELRKRQLQGKKLLQPFWITSLYA
IPYSNVFISGSWSGSLKVWKISDNLRSFELLGELSGAKGVVTKIQVVESGKHGKEKFRIL
ASIAKEHRLGRWIANVSGARNGIYSAVIDQTGF
>6ND4l:Utp24
MGKAKKTRKFGLVKRTLNTKKDQRLKKNQENIKTKEDPELTRNIPQVSSALFFQYNQAIK
PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLGPKYRIALKLA
RDPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLKQRIRKIPGIPLMSVGGHAY
VIEKLPDVF
>6ND4x:Unidentified fragment
XXXXXXXXXXXXXXXXXXXXXXXX
>6ND42:U3 snoRNA
AGGAUCAGGAAUCGUCACUCUUUGACUCUUCAAAAGAGCCACUGAAUCCAACUUGGUUGA
UGAGUCCCAUAACCUUUGUACCCAGUGAGAAACCGUAUGGCGCGAUGAUCUACCCAUGGG
UGGGUACAAAUGGCAGUCUGACAAGU
>6ND4H:Utp17
MTQSLGIEQYKLSVVSGGKPALNNLSSVTGNKNIARLSQDQRNYIIPFNNQIKVYSVETR
QCVKTLKFANNSLLSGIFLQEEENNESIVKILLGDITVPQQEDAHLITVFTNNGHVIVLN
YKGKLVESPKHFKISLADEKLANVFHSEGNYRILTTFKDPSQKAHNSLQSYRLYALTFDD
AKKQFEVAHQAEWHNVILSNISSNGKLLAHMCKDVSTKDHEHKSISVVSLFDDSVNLSFP
LGSILSSQTQSLSYNTRYVSSMAIDNMGQQLAVGFASGVISIVSLADLQIRLLKWHIDSV
LSLSFSHDGSYLLSGGWEKVMSLWQLETNSQQFLPRLNGIIIDCQVLGPQGNYYSLILQM
TENNSNSDYQFLLLNASDLTSKLSINGPLPVFNSTIKHIQQPISAMNTKNSNSITSLNHS
KKKQSRKLIKSRRQDFTTNVEINPINKNLYFPHISAVQIFDFYKNEQVNYQYLTSGVNNS
MGKVRFELNLQDPIITDLKFTKDGQWMITYEIEYPPNDLLSSKDLTHILKFWTKNDNETN
WNLKTKVINPHGISVPITKILPSPRSVNNSQGCLTADNNGGLKFWSFDSHESNWCLKKIS
LPNFNHFSNSVSLAWSQDGSLIFHGFDDKLQILDFDTFKKFESLENTKTVSEFTLDSEIQ
TVKLINDTNLIVATRTTLNAINLLRGQVINSFDLYPFVNGVYKNGHMDRLITCDERTGNI
ALVINQQLTDLDGVPTINYKSRIIIFDSDLSTKLGNFTHHEYISWIGWNYDTDFIFLDIE
STLGVVGTXXXXXXXXXXXXXXNDEDEEDIALEFINGEKKDKLVNMNSFTSMFDNIQNVQ
MDTFFDRVMKVLT
>6ND4I:Utp8
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLFKQA
IVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEMKKLSKLDVQNFIEFI
TSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVEIAERNTE
LWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI
>6ND4J:Utp15
MSTARPRIITSKAPLLPQQTTPEQRYWRQYTSAQLVKEHNSVTHISFNPQHPHDFAVTSS
TRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPRTILLSI
NASTHPTHVTKFHTQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAA
PHLVATGSYDGLIRLYDTRSSGSTPIYSLNHDQPVENVIAVSPTQIVSCGGNNFKVWDLT
SNKKLYERGNFNKAVTCLDYVENFDSPMQSALIASSLDGHVKVFDPLDNFQVKFGWKFSG
PVLSCAVSPSTAQGNRHLVAGLSSGLLAIRTKKKEKRSSDKENAPASFNKNAKSNNFQRM
MRGSEYQGDQEHIIHNDKVRSQRRMRAFERNINQFKWSEALDNAFVPGMAKELTLTVLQE
LRKRGKVRVALYGRDESTLEPLLNWCLKGIEDVRSASIVADWVAVVLELYGNTLESSPVL
QELMIDLKTKVRHEIHKSKEAQRIEGMLQLLTS
>6ND4K:Utp9
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHLSKIFLTISKSITQNPWNEENLL
PLWLKWLLTLKSGELNSIKDKHTKKNCKHLKSALRSSEEILPVLLGIQGRLEMLRRQAKL
REDLAQLSMQEGEDDEIEVIEHSNVISNPLQDQASPVEKLEPDSIVYANGESDEFVDASE
YKD
>6ND4L:Utp5
MDSPVLQSAYDPSGQYLCYVTVALDKQRVGVQPTQRATSSGVDTVWNENFLYLEDSKLKV
TCLKWVNLASSDTVAIILGMNNGEIWLYSVLANEVTYKFTTGNSYEIKDIDLMGNQLWCI
DSSDAFYQFDLLQFKLLQHFRINNCVQLNKLTIVPAGDSVAQLLVASHSISLIDIEEKKV
VMTFPGHVSPVSTLQVITNEFFISGAEGDRFLNVYDIHSGMTKCVLVAESDIKELSHSGQ
ADSIAVTTEDGSLEIFVDPLVSSSTKKRGNKSKKSSKKIQIVSKDGRKVPIYNAFINKDL
LNVSWLQNATMPYFKNLQWREIPNEYTVEISLNWNNKNKSADRDLHGKDLASATNYVEGN
ARVTSGDNFKHVDDAIKSWERELTSLEQEQAKPPQANELLTETFGDKLESSTVARISGKK
TNLKGSNLKTATTTGTVTVILSQALQSNDHSLLETVLNNRDERVIRDTIFRLKPALAVIL
LERLAERIARQTHRQGPLNVWVKWCLIIHGGYLVSIPNLMSTLSSLHSTLKRRSDLLPRL
LALDARLDCTINKFKTLNYEAGDIHSSEPVVEEDEDDVEYNEELDDAGLIEDGEESYGSE
EEEEGDSDNEEEQKHTSSKQDGRLETEQSDGEEEAGYSDVEME
>6ND4M:Utp10
MSSLSDQLAQVASNNATVALDRKRRQKLHSASLIYNSKTAATQDYDFIFENASKALEELS
QIEPKFAIFSRTLFSESSISLDRNVQTKEEIKDLDNAINAYLLLASSKWYLAPTLHATEW
LVRRFQIHVKNTEMLLLSTLNYYQTPVFKRILSIIKLPPLFNCLSNFVRSEKPPTALTMI
KLFNDMDFLKLYTSYLDQCIKHNATYTNQLLFTTCCFINVVAFNSNNDEKLNQLVPILLE
ISAKLLASKSKDCQIAAHTILVVFATALPLKKTIILAAMETILSNLDAKEAKHSALLTIC
KLFQTLKGQGNVDQLPSKIFKLFDSKFDTVSILTFLDKEDKPVCDKFITSYTRSIARYDR
SKLNIILSLLKKIRLERYEVRLIITDLIYLSEILEDKSQLVELFEYFISINEDLVLKCLK
SLGLTGELFEIRLTTSLFTNADVNTDIVKQLSDPVETTKKDTASFQTFLDKHSELINTTN
VSMLTETGERYKKVLSLFTEAIGKGYKASSFLTSFFTTLESRITFLLRVTISPAAPTALK
LISLNNIAKYINSIEKEVNIFTLVPCLICALRDASIKVRTGVKKILSLIAKRPSTKHYFL
SDKLYGENVTIPMLNPKDSEAWLSGFLNEYVTENYDISRILTPKRNEKVFLMFWANQALL
IPSPYAKTVLLDNLNKSPTYASSYSSLFEEFISHYLENRSSWEKSCIANKTNFEHFERSL
VNLVSPKEKQSFMIDFVLSALNSDYEQLANIAAERLISIFASLNNAQKLKIVQNIVDSSS
NVESSYDTVGVLQSLPLDSDIFVSILNQNSISNEMDQTDFSKRRRRRSSTSKNAFLKEEV
SQLAELHLRKLTIILEALDKVRNVGSEKLLFTLLSLLSDLETLDQDGGLPVLYAQETLIS
CTLNTITYLKEHGCTELTNVRADILVSAIRNSASPQVQNKLLLVIGSLATLSSEVILHSV
MPIFTFMGAHSIRQDDEFTTKVVERTILTVVPALIKNSKGNEKEEMEFLLLSFTTALQHV
PRHRRVKLFSTLIKTLDPVKALGSFLFLIAQQYSSALVNFKIGEARILIEFIKALLVDLH
VNEELSGLNDLLDIIKLLTSSKSSSEKKKSLESRVLFSNGVLNFSESEFLTFMNNTFEFI
NKITEETDQDYYDVRRNLRLKVYSVLLDETSDKKLIRNIREEFGTLLEGVLFFINSVELT
FSCITSQENEEASDSETSLSDHTTEIKEILFKVLGNVLQILPVDEFVNAVLPLLSTSTNE
DIRYHLTLVIGSKFELEGSEAIPIVNNVMKVLLDRMPLESKSVVISQVILNTMTALVSKY
GKKLEGSILTQALTLATEKVSSDMTEVKISSLALITNCVQVLGVKSIAFYPKIVPPSIKL
FDASLADSSNPLKEQLQVAILLLFAGLIKRIPSFLMSNILDVLHVIYFSREVDSSIRLSV
ISLIIENIDLKEVLKVLFRIWSTEIATSNDTVAVSLFLSTLESTVENIDKKSATSQSPIF
FKLLLSLFEFRSISSFDNNTISRIEASVHEISNSYVLKMNDKVFRPLFVILVRWAFDGEG
VTNAGITETERLLAFFKFFNKLQENLRGIITSYFTYLLEPVDMLLKRFISKDMENVNLRR
LVINSLTSSLKFDRDEYWKSTSRFELISVSLVNQLSNIENSIGKYLVKAIGALASNNSGV
DEHNQILNKLIVEHMKASCSSNEKLWAIRAMKLIYSKIGESWLVLLPQLVPVIAELLEDD
DEEIEREVRTGLVKVVENVLGEPFDRYLD