Sequence (fasta): 6n9dDownload

>6N9DA:Stromelysin-1
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADI
MISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHE
IGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYG
>6N9DB:Metalloproteinase inhibitor 1
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTGYQRYEIKMTKMYKGFQALGDAADIRF
VYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTY
TVGCEECTVFPCPSIPCKLQSGTHCLWTDQCLQASEKGFQSRHLACLPREPGLCTWQSLR
SQIA